QOX4 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

QOX4 - Quinol oxidase subunit 4

UniProt:	P34959	Sequences: MANKSAEHSHFPWKHIVGFILSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLLMFMHMTESENGTIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHSGHNE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (100)
Sequences:	796 (568)
Seq/√Len:	56.8

ECOLI - CYOD
BACSU - QOX4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_P	16_I	3.734	1.00
80_F	84_G	3.010	1.00
29_A	47_I	2.816	1.00
22_S	58_Q	2.635	1.00
29_A	50_F	2.288	1.00
39_S	42_A	2.008	1.00
87_V	91_G	2.006	1.00
55_A	58_Q	1.969	1.00
31_W	35_Y	1.939	1.00
23_I	27_L	1.936	1.00
48_F	92_S	1.828	0.99
38_L	43_K	1.779	0.99
99_H	102_H	1.777	0.99
98_A	102_H	1.747	0.99
38_L	42_A	1.735	0.99
16_I	20_I	1.655	0.99
10_H	14_K	1.650	0.99
31_W	71_G	1.623	0.99
30_L	63_M	1.608	0.99
91_G	99_H	1.590	0.98
42_A	46_I	1.579	0.98
32_V	38_L	1.543	0.98
82_F	86_I	1.538	0.98
68_S	75_V	1.507	0.98
20_I	24_V	1.479	0.97
58_Q	77_N	1.455	0.97
84_G	88_I	1.436	0.97
24_V	28_L	1.432	0.97
91_G	96_F	1.414	0.97
58_Q	63_M	1.401	0.96
6_A	69_E	1.377	0.96
14_K	61_M	1.360	0.96
57_L	103_G	1.296	0.95
68_S	71_G	1.248	0.93
45_W	49_G	1.228	0.93
93_I	97_A	1.218	0.93
87_V	90_L	1.200	0.92
52_F	55_A	1.199	0.92
32_V	43_K	1.197	0.92
92_S	100_Y	1.194	0.92
48_F	93_I	1.180	0.91
51_A	95_I	1.162	0.91
68_S	72_T	1.128	0.89
8_H	14_K	1.119	0.89
95_I	99_H	1.113	0.89
24_V	53_I	1.101	0.88
59_L	95_I	1.095	0.88
93_I	96_F	1.094	0.88
41_S	45_W	1.089	0.88
59_L	65_M	1.057	0.86
72_T	98_A	1.053	0.86
42_A	82_F	1.040	0.85
91_G	98_A	1.035	0.85
39_S	45_W	1.034	0.85
48_F	89_V	1.020	0.84
84_G	87_V	1.012	0.83
59_L	78_T	0.957	0.80
96_F	101_H	0.931	0.78
33_A	57_L	0.926	0.78
75_V	83_F	0.921	0.77
7_E	47_I	0.914	0.77
85_A	102_H	0.897	0.75
39_S	82_F	0.894	0.75
33_A	36_T	0.891	0.75
52_F	56_A	0.884	0.74
39_S	88_I	0.880	0.74
11_F	82_F	0.879	0.74
73_I	87_V	0.879	0.74
85_A	89_V	0.874	0.73
69_E	74_Q	0.849	0.71
96_F	99_H	0.840	0.70
84_G	93_I	0.840	0.70
80_F	99_H	0.820	0.69
90_L	97_A	0.806	0.67
12_P	44_L	0.801	0.67
28_L	50_F	0.793	0.66
80_F	87_V	0.785	0.65
94_W	100_Y	0.778	0.64
85_A	99_H	0.773	0.64
73_I	96_F	0.769	0.64
29_A	58_Q	0.766	0.63
19_F	87_V	0.761	0.63
23_I	53_I	0.755	0.62
72_T	77_N	0.753	0.62
17_V	92_S	0.749	0.61
17_V	20_I	0.746	0.61
23_I	52_F	0.745	0.61
75_V	96_F	0.740	0.61
48_F	74_Q	0.734	0.60
36_T	40_S	0.729	0.59
44_L	83_F	0.724	0.59
53_I	56_A	0.724	0.59
63_M	103_G	0.715	0.58
76_G	88_I	0.706	0.57
36_T	48_F	0.703	0.57
6_A	24_V	0.701	0.56
7_E	86_I	0.699	0.56
79_L	82_F	0.687	0.55
86_I	101_H	0.686	0.55
23_I	83_F	0.685	0.55
19_F	53_I	0.682	0.54
31_W	36_T	0.677	0.54
32_V	50_F	0.668	0.53
58_Q	88_I	0.663	0.52
69_E	73_I	0.660	0.52
10_H	22_S	0.653	0.51
31_W	93_I	0.647	0.51
72_T	85_A	0.637	0.49
73_I	99_H	0.631	0.49
56_A	78_T	0.630	0.49
32_V	37_D	0.629	0.49
95_I	104_D	0.627	0.48
60_L	102_H	0.625	0.48
83_F	86_I	0.620	0.48
33_A	43_K	0.620	0.48
72_T	75_V	0.616	0.47
20_I	28_L	0.615	0.47
86_I	90_L	0.613	0.47
46_I	101_H	0.612	0.47
12_P	40_S	0.603	0.46
56_A	60_L	0.602	0.46
35_Y	51_A	0.595	0.45
65_M	69_E	0.593	0.45
21_L	89_V	0.578	0.43
46_I	53_I	0.574	0.43
36_T	43_K	0.566	0.42
92_S	97_A	0.563	0.41
5_S	17_V	0.559	0.41
36_T	94_W	0.557	0.41
46_I	50_F	0.555	0.41
29_A	66_T	0.552	0.40
36_T	100_Y	0.552	0.40
91_G	95_I	0.550	0.40
46_I	51_A	0.543	0.39
21_L	81_G	0.543	0.39
82_F	89_V	0.538	0.39
7_E	13_W	0.533	0.38
65_M	78_T	0.530	0.38
82_F	90_L	0.525	0.37
30_L	57_L	0.518	0.37
26_T	54_Q	0.517	0.37
97_A	101_H	0.514	0.36
22_S	51_A	0.514	0.36
78_T	96_F	0.513	0.36
20_I	41_S	0.511	0.36
81_G	103_G	0.510	0.36
44_L	59_L	0.508	0.36
9_S	13_W	0.507	0.36
84_G	90_L	0.500	0.35
16_I	63_M	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bg9C	1	0.7823	17.5	0.935	Contact Map
2bg9A	1	0.7903	16.9	0.936	Contact Map
2bg9E	1	0.7823	15.4	0.937	Contact Map
2xq2A	2	0.5081	12.8	0.939	Contact Map
2bg9B	1	0.8065	9.6	0.942	Contact Map
2ksrA	1	0.7097	8.5	0.944	Contact Map
2l8sA	1	0.3629	5.3	0.949	Contact Map
3dh4A	3	0.75	5.2	0.949	Contact Map
2mfrA	1	0.4355	3.9	0.952	Contact Map
4hfiA	3	0.7258	3.3	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.