YLXP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLXP - Uncharacterized protein YlxP

UniProt:	P32730	Sequences: MIGFAECECIIYDAGSLKEKRAVLKRILTRVQNKFNVSISEIGYQDTWQRTSFGIAAVSSSRVQTEKELQRVLAFIDSFPEIERTITRTEWF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	92 (89)
Sequences:	645 (470)
Seq/√Len:	49.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_G	69_L	2.720	1.00
43_G	52_S	2.665	1.00
27_I	82_I	2.563	1.00
11_I	14_A	2.538	1.00
70_Q	89_T	2.319	1.00
7_C	76_I	2.240	1.00
45_Q	60_S	2.232	1.00
14_A	19_E	2.144	1.00
11_I	23_V	2.126	1.00
42_I	54_G	2.095	1.00
9_C	82_I	2.054	1.00
31_V	39_I	2.028	1.00
42_I	58_V	1.991	1.00
8_E	50_R	1.806	0.99
62_R	66_E	1.787	0.99
38_S	57_A	1.700	0.98
3_G	65_T	1.696	0.98
37_V	72_V	1.638	0.98
9_C	76_I	1.568	0.97
31_V	72_V	1.562	0.97
54_G	58_V	1.553	0.97
59_S	65_T	1.529	0.97
84_R	87_T	1.496	0.96
14_A	23_V	1.472	0.96
44_Y	52_S	1.445	0.96
31_V	37_V	1.429	0.95
71_R	74_A	1.424	0.95
42_I	52_S	1.409	0.95
6_E	52_S	1.394	0.95
57_A	65_T	1.356	0.94
72_V	75_F	1.336	0.93
28_L	39_I	1.316	0.93
25_K	29_T	1.286	0.92
12_Y	49_Q	1.181	0.88
5_A	69_L	1.134	0.86
20_K	46_D	1.127	0.86
31_V	55_I	1.127	0.86
10_I	50_R	1.123	0.86
35_F	75_F	1.114	0.85
15_G	49_Q	1.109	0.85
2_I	56_A	1.097	0.84
29_T	33_N	1.094	0.84
25_K	28_L	1.042	0.81
15_G	19_E	1.030	0.80
77_D	84_R	1.026	0.80
66_E	89_T	1.012	0.79
32_Q	36_N	1.005	0.79
55_I	72_V	1.002	0.78
73_L	87_T	0.976	0.76
5_A	55_I	0.969	0.76
44_Y	47_T	0.944	0.74
10_I	83_E	0.944	0.74
11_I	51_T	0.906	0.71
8_E	86_I	0.901	0.70
14_A	48_W	0.893	0.70
9_C	51_T	0.887	0.69
22_A	26_R	0.884	0.69
59_S	64_Q	0.881	0.69
24_L	51_T	0.851	0.66
44_Y	50_R	0.848	0.66
66_E	70_Q	0.834	0.64
19_E	22_A	0.831	0.64
64_Q	67_K	0.820	0.63
11_I	19_E	0.806	0.62
10_I	85_T	0.801	0.61
4_F	56_A	0.798	0.61
15_G	46_D	0.792	0.60
7_C	84_R	0.791	0.60
34_K	58_V	0.788	0.60
13_D	80_P	0.785	0.60
38_S	78_S	0.780	0.59
24_L	28_L	0.775	0.59
30_R	33_N	0.770	0.58
53_F	75_F	0.755	0.57
46_D	65_T	0.730	0.54
13_D	27_I	0.729	0.54
77_D	87_T	0.716	0.53
4_F	42_I	0.712	0.52
51_T	82_I	0.711	0.52
74_A	86_I	0.702	0.51
23_V	35_F	0.698	0.51
36_N	90_E	0.697	0.51
26_R	30_R	0.695	0.51
37_V	59_S	0.693	0.50
10_I	13_D	0.673	0.48
40_S	60_S	0.670	0.48
29_T	34_K	0.668	0.48
73_L	77_D	0.667	0.48
27_I	76_I	0.663	0.47
34_K	47_T	0.654	0.46
13_D	48_W	0.645	0.46
39_I	55_I	0.642	0.45
25_K	54_G	0.639	0.45
13_D	22_A	0.638	0.45
63_V	67_K	0.632	0.44
53_F	69_L	0.631	0.44
4_F	72_V	0.623	0.43
22_A	87_T	0.607	0.42
38_S	64_Q	0.602	0.41
39_I	76_I	0.600	0.41
64_Q	71_R	0.598	0.41
54_G	74_A	0.597	0.41
5_A	87_T	0.596	0.41
40_S	56_A	0.585	0.40
28_L	35_F	0.583	0.39
19_E	32_Q	0.582	0.39
36_N	66_E	0.580	0.39
15_G	37_V	0.578	0.39
51_T	68_E	0.570	0.38
69_L	72_V	0.569	0.38
28_L	56_A	0.569	0.38
32_Q	38_S	0.568	0.38
4_F	69_L	0.564	0.38
67_K	82_I	0.555	0.37
25_K	65_T	0.546	0.36
35_F	71_R	0.543	0.36
2_I	29_T	0.536	0.35
66_E	77_D	0.533	0.35
4_F	7_C	0.532	0.35
24_L	90_E	0.531	0.34
65_T	68_E	0.530	0.34
14_A	49_Q	0.526	0.34
22_A	25_K	0.526	0.34
24_L	45_Q	0.525	0.34
79_F	82_I	0.523	0.34
69_L	89_T	0.521	0.34
59_S	73_L	0.520	0.33
40_S	58_V	0.516	0.33
31_V	63_V	0.508	0.32
8_E	48_W	0.506	0.32
36_N	57_A	0.504	0.32
56_A	90_E	0.502	0.32
51_T	80_P	0.501	0.32
70_Q	74_A	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1j27A	2	0.9891	100	0.111	Contact Map
4jj9A	3	0.6739	6	0.933	Contact Map
4bejA	2	0.4565	5.5	0.934	Contact Map
3mf7A	3	0.5761	5.4	0.934	Contact Map
2l2lA	1	0.4674	4.5	0.936	Contact Map
2oniA	4	0.8587	4.1	0.938	Contact Map
3d9wA	2	0.5978	4	0.938	Contact Map
3g13A	2	0.5109	3.9	0.939	Contact Map
3iclA	1	0.913	3.9	0.939	Contact Map
2jxuA	1	0.7391	3.7	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.