YLXQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLXQ - Probable ribosomal protein YlxQ

UniProt:	P32729	Sequences: MSGMEWFPLLGLANRARKVVSGEDLVIKEIRNARAKLVLLTEDASSNTAKKVTDKCNYYKVPYKKVESRAVLGRSIGKEARVVVAVTDQGFANKLISLLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	100 (96)
Sequences:	762 (601)
Seq/√Len:	61.3

BACSU - YLXQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_A	85_A	3.653	1.00
68_S	71_V	3.115	1.00
94_K	97_S	3.089	1.00
18_K	88_D	2.786	1.00
69_R	82_V	2.375	1.00
14_N	17_R	2.155	1.00
50_K	54_D	2.151	1.00
49_A	65_K	2.059	1.00
94_K	98_L	2.030	1.00
27_I	55_K	1.915	1.00
27_I	52_V	1.795	1.00
7_F	67_E	1.689	0.99
89_Q	93_N	1.683	0.99
14_N	78_K	1.590	0.99
12_L	91_F	1.548	0.99
44_A	48_T	1.529	0.98
21_S	81_R	1.528	0.98
6_W	95_L	1.527	0.98
38_V	56_C	1.523	0.98
73_G	80_A	1.510	0.98
14_N	19_V	1.482	0.98
69_R	73_G	1.467	0.98
36_K	89_Q	1.402	0.97
29_E	87_T	1.396	0.97
45_S	48_T	1.377	0.97
19_V	76_I	1.359	0.97
30_I	55_K	1.356	0.97
55_K	59_Y	1.300	0.96
39_L	95_L	1.292	0.96
9_L	98_L	1.271	0.95
9_L	94_K	1.254	0.95
26_V	83_V	1.250	0.95
56_C	63_Y	1.249	0.95
53_T	63_Y	1.246	0.95
14_N	76_I	1.235	0.94
35_A	87_T	1.230	0.94
23_E	81_R	1.210	0.94
76_I	84_V	1.205	0.94
53_T	65_K	1.197	0.93
27_I	31_R	1.141	0.92
52_V	83_V	1.140	0.92
29_E	34_R	1.140	0.92
40_L	63_Y	1.115	0.91
40_L	49_A	1.105	0.90
55_K	58_Y	1.098	0.90
9_L	95_L	1.096	0.90
6_W	66_V	1.075	0.89
42_E	65_K	1.070	0.89
4_M	66_V	1.067	0.89
20_V	87_T	1.059	0.88
28_K	32_N	1.056	0.88
40_L	52_V	1.051	0.88
54_D	57_N	1.047	0.88
13_A	19_V	1.045	0.88
33_A	61_V	0.987	0.84
54_D	59_Y	0.986	0.84
54_D	58_Y	0.970	0.83
4_M	67_E	0.956	0.82
29_E	85_A	0.947	0.82
46_S	49_A	0.944	0.82
30_I	56_C	0.942	0.81
20_V	85_A	0.922	0.80
26_V	38_V	0.921	0.80
13_A	91_F	0.895	0.78
25_L	52_V	0.870	0.76
37_L	64_K	0.865	0.76
31_R	59_Y	0.864	0.75
64_K	99_L	0.859	0.75
69_R	80_A	0.852	0.74
50_K	58_Y	0.850	0.74
11_G	75_S	0.847	0.74
23_E	54_D	0.846	0.74
39_L	66_V	0.812	0.71
30_I	59_Y	0.811	0.71
12_L	15_R	0.808	0.70
53_T	57_N	0.806	0.70
52_V	69_R	0.796	0.69
64_K	96_I	0.786	0.68
61_V	72_L	0.785	0.68
46_S	53_T	0.780	0.68
24_D	83_V	0.777	0.67
30_I	35_A	0.765	0.66
10_L	95_L	0.762	0.66
16_A	90_G	0.758	0.66
28_K	31_R	0.748	0.65
7_F	39_L	0.747	0.64
31_R	58_Y	0.711	0.61
73_G	79_E	0.709	0.60
12_L	75_S	0.709	0.60
4_M	7_F	0.697	0.59
26_V	85_A	0.696	0.59
35_A	38_V	0.693	0.59
7_F	71_V	0.689	0.58
42_E	67_E	0.685	0.58
13_A	86_V	0.680	0.57
39_L	93_N	0.671	0.56
24_D	52_V	0.669	0.56
27_I	82_V	0.666	0.56
42_E	68_S	0.663	0.55
14_N	21_S	0.652	0.54
10_L	99_L	0.644	0.53
50_K	55_K	0.644	0.53
6_W	9_L	0.642	0.53
19_V	86_V	0.634	0.52
47_N	51_K	0.626	0.51
41_T	73_G	0.616	0.50
37_L	92_A	0.616	0.50
49_A	53_T	0.616	0.50
93_N	96_I	0.605	0.49
38_V	54_D	0.605	0.49
23_E	55_K	0.596	0.48
6_W	67_E	0.594	0.47
10_L	19_V	0.591	0.47
40_L	44_A	0.590	0.47
21_S	45_S	0.586	0.47
42_E	66_V	0.582	0.46
39_L	84_V	0.582	0.46
46_S	65_K	0.578	0.46
24_D	27_I	0.573	0.45
23_E	58_Y	0.572	0.45
9_L	23_E	0.571	0.45
43_D	92_A	0.570	0.45
49_A	70_A	0.567	0.44
30_I	85_A	0.559	0.44
10_L	44_A	0.555	0.43
11_G	18_K	0.543	0.42
9_L	91_F	0.542	0.42
10_L	76_I	0.536	0.41
44_A	47_N	0.535	0.41
30_I	50_K	0.530	0.40
15_R	92_A	0.527	0.40
47_N	71_V	0.524	0.40
5_E	98_L	0.524	0.40
16_A	91_F	0.523	0.40
24_D	28_K	0.521	0.39
30_I	53_T	0.520	0.39
61_V	89_Q	0.519	0.39
74_R	79_E	0.518	0.39
15_R	31_R	0.510	0.38
51_K	54_D	0.510	0.38
26_V	96_I	0.508	0.38
73_G	82_V	0.504	0.38
32_N	91_F	0.503	0.37
32_N	42_E	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3on1A	1	0.98	99.9	0.298	Contact Map
3v7qA	1	0.97	99.9	0.301	Contact Map
3cpqA	2	0.95	99.9	0.358	Contact Map
3u5ec	1	0.95	99.9	0.372	Contact Map
3j61c	1	1	99.9	0.379	Contact Map
3zf7g	1	0.94	99.9	0.385	Contact Map
1w41A	1	0.97	99.9	0.391	Contact Map
1vx76	1	0.96	99.9	0.392	Contact Map
4a18G	1	0.94	99.9	0.392	Contact Map
2fc3A	1	1	99.9	0.394	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.