CSPB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CSPB - Cold shock protein CspB

UniProt:	P32081	Sequences: MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	67 (62)
Sequences:	4302 (1607)
Seq/√Len:	204.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_V	63_V	3.747	1.00
52_V	61_A	3.437	1.00
50_E	62_N	2.754	1.00
48_S	64_T	2.252	1.00
3_E	48_S	2.157	1.00
5_K	46_A	2.103	1.00
11_S	42_E	1.996	1.00
34_Q	64_T	1.937	1.00
3_E	46_A	1.834	1.00
20_V	24_D	1.726	1.00
28_V	41_L	1.706	1.00
54_G	59_Q	1.677	1.00
42_E	45_Q	1.673	1.00
34_Q	62_N	1.603	1.00
53_E	58_P	1.602	1.00
20_V	23_Q	1.570	1.00
32_A	61_A	1.536	1.00
11_S	38_F	1.502	1.00
21_E	46_A	1.393	1.00
20_V	49_F	1.387	1.00
54_G	58_P	1.320	1.00
11_S	40_T	1.308	1.00
26_V	51_I	1.288	1.00
5_K	19_E	1.228	1.00
9_F	30_F	1.215	1.00
51_I	58_P	1.174	1.00
33_I	38_F	1.172	1.00
24_D	58_P	1.170	1.00
30_F	39_K	1.090	1.00
18_I	49_F	1.071	1.00
54_G	57_G	1.070	1.00
52_V	59_Q	1.037	1.00
33_I	39_K	0.992	1.00
4_G	18_I	0.973	1.00
32_A	52_V	0.968	1.00
41_L	47_V	0.952	0.99
49_F	60_A	0.867	0.99
33_I	36_E	0.816	0.98
4_G	60_A	0.812	0.98
8_W	28_V	0.805	0.98
32_A	62_N	0.791	0.98
19_E	44_G	0.787	0.98
30_F	56_R	0.773	0.98
18_I	60_A	0.737	0.97
30_F	33_I	0.736	0.97
35_G	39_K	0.731	0.97
7_K	25_D	0.710	0.96
3_E	21_E	0.709	0.96
7_K	13_K	0.705	0.96
13_K	25_D	0.694	0.95
10_N	27_F	0.691	0.95
36_E	64_T	0.683	0.95
18_I	47_V	0.674	0.95
20_V	51_I	0.661	0.94
14_G	25_D	0.649	0.94
5_K	21_E	0.644	0.93
26_V	60_A	0.639	0.93
30_F	38_F	0.628	0.92
33_I	41_L	0.624	0.92
4_G	49_F	0.623	0.92
12_E	45_Q	0.622	0.92
13_K	37_G	0.615	0.92
15_F	26_V	0.609	0.91
30_F	63_V	0.604	0.91
26_V	52_V	0.603	0.91
55_N	59_Q	0.599	0.91
33_I	63_V	0.598	0.91
17_F	44_G	0.595	0.90
35_G	38_F	0.583	0.89
22_G	55_N	0.581	0.89
18_I	28_V	0.575	0.89
16_G	28_V	0.575	0.89
38_F	42_E	0.554	0.87
31_S	56_R	0.552	0.87
17_F	29_H	0.546	0.86
7_K	19_E	0.545	0.86
35_G	40_T	0.542	0.86
50_E	61_A	0.540	0.86
53_E	56_R	0.539	0.85
5_K	44_G	0.536	0.85
8_W	13_K	0.533	0.85
4_G	31_S	0.526	0.84
41_L	45_Q	0.523	0.84
12_E	20_V	0.522	0.84
9_F	14_G	0.521	0.83
53_E	59_Q	0.518	0.83
26_V	32_A	0.517	0.83
34_Q	39_K	0.508	0.82
31_S	50_E	0.504	0.81
36_E	39_K	0.503	0.81
8_W	43_E	0.501	0.81
32_A	49_F	0.501	0.81
12_E	56_R	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lxjA	1	0.9851	99.8	0.132	Contact Map
1c9oA	2	0.9851	99.8	0.142	Contact Map
3camA	2	0.9851	99.8	0.144	Contact Map
3a0jA	1	1	99.7	0.156	Contact Map
3i2zB	2	0.9851	99.7	0.169	Contact Map
1g6pA	1	0.9851	99.7	0.172	Contact Map
2mqhA	1	0.9552	99.7	0.184	Contact Map
3uljA	3	1	99.7	0.186	Contact Map
2lssA	1	0.9851	99.7	0.194	Contact Map
3ts2A	1	1	99.7	0.199	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.