CH10 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CH10 - 10 kDa chaperonin

UniProt:	P28599	Sequences: MLKPLGDRVVIELVESEEKTASGIVLPDSAKEKPQEGKIVAAGSGRVLESGERVALEVKEGDRIIFSKYAGTEVKYEGTEYLILRESDILAVIG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	94 (92)
Sequences:	2697 (1173)
Seq/√Len:	122.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_E	79_T	4.291	1.00
12_E	38_K	3.840	1.00
9_V	89_I	2.844	1.00
47_V	53_R	2.626	1.00
75_K	80_E	2.434	1.00
48_L	52_E	2.331	1.00
13_L	66_F	2.203	1.00
36_E	63_R	2.135	1.00
41_A	60_E	1.969	1.00
48_L	54_V	1.968	1.00
59_K	62_D	1.953	1.00
58_V	89_I	1.896	1.00
40_V	81_Y	1.839	1.00
37_G	66_F	1.811	1.00
18_E	31_K	1.719	1.00
67_S	70_A	1.717	1.00
2_L	91_A	1.656	1.00
2_L	10_V	1.605	1.00
38_K	63_R	1.586	1.00
10_V	83_I	1.537	1.00
14_V	63_R	1.495	1.00
3_K	92_V	1.493	1.00
14_V	38_K	1.489	1.00
19_K	25_V	1.486	1.00
56_L	86_E	1.469	1.00
44_S	57_E	1.429	1.00
73_E	80_E	1.422	1.00
57_E	86_E	1.418	1.00
42_A	56_L	1.393	1.00
69_Y	85_R	1.355	1.00
66_F	82_L	1.347	1.00
11_I	84_L	1.326	1.00
11_I	37_G	1.310	1.00
46_R	87_S	1.264	1.00
37_G	84_L	1.257	1.00
35_Q	68_K	1.206	0.99
38_K	60_E	1.184	0.99
38_K	61_G	1.175	0.99
8_R	85_R	1.151	0.99
12_E	81_Y	1.146	0.99
35_Q	72_T	1.137	0.99
28_D	31_K	1.111	0.99
64_I	89_I	1.103	0.99
68_K	73_E	1.074	0.98
44_S	56_L	1.072	0.98
34_P	68_K	1.051	0.98
14_V	36_E	1.038	0.98
7_D	85_R	1.027	0.98
20_T	23_G	0.958	0.97
83_I	90_L	0.940	0.96
46_R	86_E	0.913	0.96
53_R	57_E	0.895	0.95
10_V	81_Y	0.886	0.95
76_Y	81_Y	0.864	0.94
6_G	57_E	0.863	0.94
72_T	88_D	0.850	0.94
62_D	92_V	0.841	0.93
58_V	92_V	0.837	0.93
14_V	37_G	0.798	0.91
2_L	83_I	0.783	0.91
46_R	69_Y	0.781	0.91
69_Y	81_Y	0.772	0.90
67_S	90_L	0.768	0.90
7_D	45_G	0.767	0.90
47_V	54_V	0.764	0.90
71_G	74_V	0.763	0.90
14_V	27_P	0.756	0.89
6_G	26_L	0.755	0.89
67_S	73_E	0.755	0.89
12_E	15_E	0.726	0.87
47_V	51_G	0.718	0.87
34_P	72_T	0.715	0.86
76_Y	91_A	0.706	0.86
45_G	51_G	0.705	0.86
27_P	67_S	0.704	0.85
42_A	60_E	0.703	0.85
13_L	87_S	0.697	0.85
32_E	68_K	0.695	0.85
68_K	71_G	0.685	0.84
67_S	88_D	0.680	0.83
13_L	33_K	0.680	0.83
65_I	74_V	0.674	0.83
59_K	92_V	0.670	0.83
6_G	53_R	0.669	0.82
31_K	73_E	0.667	0.82
37_G	82_L	0.664	0.82
11_I	64_I	0.660	0.82
46_R	85_R	0.651	0.81
45_G	56_L	0.651	0.81
44_S	53_R	0.650	0.81
58_V	86_E	0.647	0.80
68_K	88_D	0.641	0.80
16_S	22_S	0.639	0.80
8_R	67_S	0.637	0.79
2_L	65_I	0.623	0.78
47_V	57_E	0.621	0.78
25_V	37_G	0.613	0.77
18_E	26_L	0.608	0.76
68_K	72_T	0.607	0.76
8_R	71_G	0.607	0.76
66_F	84_L	0.606	0.76
23_G	64_I	0.605	0.76
17_E	20_T	0.602	0.75
27_P	30_A	0.593	0.74
73_E	77_E	0.591	0.74
47_V	55_A	0.580	0.73
46_R	53_R	0.578	0.72
17_E	21_A	0.575	0.72
21_A	77_E	0.573	0.72
33_K	68_K	0.572	0.72
44_S	48_L	0.571	0.72
85_R	88_D	0.560	0.70
25_V	48_L	0.558	0.70
75_K	78_G	0.551	0.69
21_A	29_S	0.549	0.69
47_V	50_S	0.548	0.68
6_G	44_S	0.546	0.68
38_K	79_T	0.541	0.67
35_Q	73_E	0.539	0.67
70_A	84_L	0.537	0.67
7_D	86_E	0.534	0.66
44_S	47_V	0.533	0.66
65_I	90_L	0.531	0.66
44_S	92_V	0.528	0.66
32_E	78_G	0.527	0.65
16_S	44_S	0.527	0.65
11_I	65_I	0.518	0.64
48_L	53_R	0.517	0.64
15_E	18_E	0.517	0.64
19_K	23_G	0.517	0.64
8_R	83_I	0.517	0.64
26_L	65_I	0.516	0.64
4_P	7_D	0.512	0.63
13_L	36_E	0.510	0.63
16_S	21_A	0.507	0.62
2_L	74_V	0.506	0.62
39_I	55_A	0.502	0.62
18_E	28_D	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pj1O	3	1	100	0.056	Contact Map
3nx6A	1	0.7979	100	0.057	Contact Map
1we3O	3	1	100	0.059	Contact Map
1pcqO	3	1	100	0.064	Contact Map
1p3hA	5	1	100	0.073	Contact Map
1g31A	4	0.883	99.9	0.258	Contact Map
3ukoA	4	0.8936	50.5	0.893	Contact Map
4c4oA	4	0.8936	48.9	0.894	Contact Map
1e3iA	2	0.8936	47.4	0.895	Contact Map
2jhfA	2	0.8936	47.3	0.895	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.