SP5G - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP5G - Putative septation protein SpoVG

UniProt:	P28015	Sequences: MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFEEAGAS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	97 (88)
Sequences:	530 (314)
Seq/√Len:	33.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_E	82_R	3.984	1.00
70_G	74_D	3.480	1.00
28_E	71_K	2.619	1.00
29_F	61_T	2.243	0.99
68_T	72_I	2.010	0.98
25_L	31_V	2.006	0.98
19_A	36_V	1.987	0.98
9_R	32_H	1.912	0.97
2_E	71_K	1.895	0.97
28_E	68_T	1.795	0.96
83_L	86_T	1.791	0.96
74_D	78_N	1.730	0.95
8_L	84_G	1.655	0.94
2_E	27_H	1.654	0.94
79_E	83_L	1.613	0.93
13_T	57_F	1.552	0.91
78_N	82_R	1.502	0.90
32_H	46_A	1.463	0.89
32_H	62_H	1.450	0.88
7_R	30_V	1.430	0.87
42_G	73_Q	1.411	0.87
8_L	19_A	1.398	0.86
34_I	45_V	1.344	0.84
33_D	58_R	1.343	0.84
17_M	22_S	1.338	0.84
65_N	68_T	1.331	0.83
33_D	68_T	1.326	0.83
15_G	21_A	1.326	0.83
45_V	68_T	1.287	0.81
6_V	72_I	1.287	0.81
7_R	24_T	1.223	0.78
3_V	25_L	1.214	0.77
24_T	30_V	1.196	0.76
85_D	88_A	1.182	0.75
23_I	75_A	1.171	0.75
9_R	46_A	1.146	0.73
46_A	59_D	1.141	0.73
5_D	15_G	1.126	0.72
37_I	46_A	1.122	0.71
56_E	73_Q	1.121	0.71
25_L	75_A	1.098	0.70
25_L	68_T	1.098	0.70
67_S	71_K	1.070	0.68
2_E	77_L	1.068	0.68
70_G	73_Q	1.051	0.66
74_D	81_H	1.038	0.65
29_F	42_G	1.035	0.65
78_N	81_H	1.033	0.65
71_K	75_A	1.021	0.64
5_D	9_R	1.008	0.63
61_T	65_N	0.993	0.62
24_T	32_H	0.965	0.60
64_I	73_Q	0.964	0.59
8_L	21_A	0.959	0.59
67_S	70_G	0.954	0.59
17_M	53_P	0.913	0.55
20_I	68_T	0.904	0.55
30_V	64_I	0.899	0.54
34_I	76_V	0.887	0.53
16_R	46_A	0.869	0.52
32_H	64_I	0.867	0.51
23_I	72_I	0.864	0.51
37_I	69_R	0.855	0.50
19_A	24_T	0.849	0.50
18_R	38_D	0.818	0.47
25_L	40_N	0.818	0.47
75_A	79_E	0.795	0.45
66_S	70_G	0.783	0.44
25_L	30_V	0.758	0.42
6_V	75_A	0.753	0.42
17_M	54_D	0.753	0.42
78_N	84_G	0.752	0.42
13_T	45_V	0.752	0.42
46_A	61_T	0.742	0.41
41_N	53_P	0.739	0.41
22_S	53_P	0.735	0.40
20_I	32_H	0.726	0.40
39_G	44_F	0.723	0.40
9_R	64_I	0.723	0.40
20_I	34_I	0.713	0.39
45_V	79_E	0.711	0.39
15_G	76_V	0.711	0.39
13_T	25_L	0.705	0.38
52_T	57_F	0.701	0.38
8_L	85_D	0.701	0.38
9_R	17_M	0.697	0.37
62_H	69_R	0.694	0.37
41_N	78_N	0.693	0.37
22_S	33_D	0.693	0.37
18_R	34_I	0.686	0.37
34_I	57_F	0.679	0.36
33_D	50_K	0.678	0.36
5_D	35_R	0.664	0.35
20_I	58_R	0.660	0.35
26_D	50_K	0.656	0.34
41_N	75_A	0.655	0.34
28_E	67_S	0.655	0.34
25_L	72_I	0.654	0.34
45_V	65_N	0.651	0.34
31_V	61_T	0.648	0.34
30_V	73_Q	0.646	0.34
8_L	83_L	0.646	0.34
82_R	86_T	0.633	0.33
16_R	39_G	0.633	0.33
9_R	33_D	0.628	0.32
33_D	64_I	0.626	0.32
3_V	41_N	0.611	0.31
78_N	86_T	0.608	0.31
17_M	20_I	0.605	0.31
38_D	42_G	0.598	0.30
35_R	40_N	0.594	0.30
81_H	85_D	0.593	0.30
16_R	35_R	0.582	0.29
7_R	72_I	0.575	0.28
37_I	73_Q	0.570	0.28
33_D	73_Q	0.566	0.28
21_A	84_G	0.564	0.28
71_K	74_D	0.563	0.28
2_E	82_R	0.563	0.28
16_R	73_Q	0.554	0.27
2_E	16_R	0.553	0.27
37_I	61_T	0.547	0.27
65_N	73_Q	0.545	0.26
21_A	73_Q	0.540	0.26
27_H	31_V	0.527	0.25
40_N	84_G	0.524	0.25
34_I	77_L	0.519	0.25
22_S	58_R	0.518	0.25
77_L	83_L	0.510	0.24
77_L	85_D	0.510	0.24
43_L	81_H	0.503	0.24
1_M	4_T	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ia9A	2	1	100	0.088	Contact Map
2i9zA	2	0.8969	100	0.123	Contact Map
2i9xA	2	0.866	100	0.136	Contact Map
1ez4A	4	0.9278	13.6	0.929	Contact Map
7mdhA	3	0.9794	13.2	0.929	Contact Map
1ybxA	2	0.7216	12.1	0.93	Contact Map
3d0oA	4	0.866	10.7	0.932	Contact Map
4m1qA	4	0.8763	10.1	0.933	Contact Map
3ju0A	1	0.7732	9.4	0.934	Contact Map
1a5zA	3	0.9072	8.9	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.