YSXB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YSXB - Uncharacterized protein YsxB

UniProt:	P26942	Sequences: MIQATIRRSHDKGILSFEMTGHANFAEHGQDLVCAGVTAVVFGAVNAVIVLAGFEPLLDIGEDGGYFYFEFPESLDPEARQKAQLLIEGMIVSLETIERDYKDNLRVTTNII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	112 (102)
Sequences:	751 (615)
Seq/√Len:	60.9

BACSU - YSXB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_M	41_V	3.763	1.00
8_R	88_E	3.626	1.00
47_A	89_G	3.596	1.00
26_A	30_Q	3.567	1.00
2_I	37_V	3.430	1.00
43_G	93_S	3.361	1.00
19_M	37_V	2.460	1.00
40_V	93_S	2.440	1.00
90_M	94_L	2.340	1.00
6_I	91_I	2.278	1.00
42_F	46_N	2.210	1.00
39_A	97_I	2.076	1.00
18_E	68_Y	2.049	1.00
40_V	43_G	1.843	1.00
17_F	69_F	1.650	0.99
86_L	89_G	1.625	0.99
7_R	16_S	1.617	0.99
14_I	87_I	1.573	0.99
25_F	32_L	1.567	0.99
24_N	28_H	1.557	0.99
17_F	44_A	1.505	0.98
71_F	87_I	1.491	0.98
44_A	86_L	1.476	0.98
51_L	85_L	1.414	0.97
84_Q	88_E	1.408	0.97
57_L	70_E	1.339	0.96
43_G	47_A	1.330	0.96
2_I	23_A	1.287	0.95
36_G	39_A	1.239	0.94
17_F	45_V	1.229	0.94
47_A	51_L	1.182	0.93
47_A	85_L	1.168	0.92
24_N	30_Q	1.121	0.91
42_F	67_F	1.109	0.90
27_E	30_Q	1.098	0.90
21_G	65_G	1.095	0.90
28_H	64_G	1.077	0.89
52_A	89_G	1.061	0.88
100_D	104_N	1.059	0.88
17_F	67_F	1.058	0.88
43_G	46_N	1.039	0.87
42_F	60_I	1.034	0.87
19_M	105_L	1.028	0.86
89_G	93_S	1.019	0.86
48_V	69_F	1.014	0.86
91_I	95_E	1.003	0.85
45_V	67_F	1.001	0.85
2_I	65_G	0.990	0.84
54_F	83_A	0.989	0.84
25_F	30_Q	0.984	0.84
42_F	58_L	0.971	0.83
103_D	108_T	0.948	0.82
54_F	80_R	0.944	0.81
82_K	85_L	0.926	0.80
95_E	98_E	0.925	0.80
39_A	93_S	0.907	0.79
4_A	107_V	0.888	0.77
43_G	89_G	0.886	0.77
25_F	28_H	0.881	0.77
9_S	13_G	0.881	0.77
99_R	103_D	0.878	0.76
3_Q	108_T	0.877	0.76
4_A	19_M	0.877	0.76
51_L	89_G	0.863	0.75
3_Q	102_K	0.860	0.75
44_A	90_M	0.858	0.75
18_E	66_Y	0.851	0.74
39_A	43_G	0.840	0.73
32_L	35_A	0.828	0.72
9_S	15_L	0.820	0.71
6_I	14_I	0.819	0.71
27_E	103_D	0.814	0.71
41_V	67_F	0.809	0.70
45_V	69_F	0.794	0.69
48_V	89_G	0.784	0.68
2_I	19_M	0.781	0.68
40_V	97_I	0.768	0.66
82_K	88_E	0.753	0.65
56_P	69_F	0.743	0.64
59_D	68_Y	0.741	0.64
58_L	64_G	0.737	0.63
17_F	90_M	0.737	0.63
53_G	88_E	0.721	0.61
12_K	39_A	0.715	0.61
95_E	107_V	0.704	0.60
47_A	93_S	0.697	0.59
44_A	93_S	0.696	0.59
26_A	64_G	0.684	0.57
81_Q	85_L	0.682	0.57
48_V	83_A	0.678	0.57
46_N	51_L	0.675	0.56
71_F	83_A	0.671	0.56
90_M	107_V	0.670	0.56
96_T	107_V	0.666	0.55
46_N	86_L	0.663	0.55
50_V	95_E	0.662	0.55
50_V	96_T	0.656	0.54
52_A	80_R	0.655	0.54
2_I	21_G	0.651	0.54
43_G	86_L	0.649	0.53
80_R	83_A	0.644	0.53
5_T	13_G	0.643	0.53
7_R	105_L	0.643	0.53
40_V	90_M	0.641	0.53
13_G	80_R	0.640	0.52
87_I	108_T	0.637	0.52
47_A	52_A	0.634	0.52
42_F	96_T	0.623	0.51
14_I	88_E	0.621	0.50
38_T	42_F	0.618	0.50
51_L	92_V	0.618	0.50
6_I	90_M	0.612	0.49
97_I	105_L	0.610	0.49
94_L	98_E	0.608	0.49
40_V	94_L	0.606	0.49
32_L	105_L	0.602	0.48
70_E	73_E	0.602	0.48
8_R	14_I	0.601	0.48
96_T	99_R	0.598	0.48
59_D	66_Y	0.596	0.47
36_G	97_I	0.593	0.47
16_S	70_E	0.592	0.47
8_R	91_I	0.588	0.47
6_I	17_F	0.588	0.47
47_A	92_V	0.576	0.45
10_H	75_L	0.574	0.45
75_L	80_R	0.571	0.45
43_G	96_T	0.569	0.44
16_S	95_E	0.564	0.44
43_G	85_L	0.564	0.44
66_Y	84_Q	0.563	0.44
43_G	52_A	0.561	0.44
24_N	57_L	0.558	0.43
16_S	68_Y	0.556	0.43
6_I	44_A	0.550	0.42
98_E	105_L	0.547	0.42
88_E	91_I	0.542	0.41
64_G	67_F	0.535	0.41
17_F	66_Y	0.534	0.41
54_F	72_P	0.534	0.41
85_L	89_G	0.532	0.40
43_G	92_V	0.527	0.40
3_Q	105_L	0.525	0.40
14_I	91_I	0.523	0.39
3_Q	106_R	0.516	0.39
25_F	101_Y	0.512	0.38
91_I	94_L	0.512	0.38
85_L	100_D	0.512	0.38
57_L	72_P	0.509	0.38
23_A	46_N	0.508	0.38
73_E	95_E	0.504	0.37
48_V	70_E	0.502	0.37
9_S	50_V	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2idlA	2	1	100	0.12	Contact Map
2g0iA	2	0.9821	100	0.127	Contact Map
4peoA	2	0.8393	100	0.14	Contact Map
1s12A	2	0.8214	100	0.322	Contact Map
1j5kA	1	0.5625	17.3	0.927	Contact Map
4qgeA	2	0	10.8	0.933	Contact Map
3ifeA	2	0.9018	9.6	0.935	Contact Map
3k6qA	2	0.9286	9.2	0.935	Contact Map
3ramA	4	0.9375	8	0.937	Contact Map
3rzaA	2	0.9286	6.6	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.