RL21 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL21 - 50S ribosomal protein L21

UniProt:	P26908	Sequences: MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGNPTVEGATVTAKVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKINA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (100)
Sequences:	2625 (1393)
Seq/√Len:	139.3

ECOLI - RL21
BACSU - RL21

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_K	37_D	3.400	1.00
61_K	98_E	3.378	1.00
16_E	99_K	3.134	1.00
67_R	91_P	2.853	1.00
72_T	85_K	2.793	1.00
28_E	31_E	2.729	1.00
15_E	18_Q	2.681	1.00
27_A	62_V	2.454	1.00
21_Y	94_K	2.403	1.00
34_T	57_T	2.263	1.00
61_K	96_T	2.179	1.00
60_A	97_I	2.162	1.00
32_T	59_T	1.983	1.00
35_F	95_V	1.916	1.00
77_K	82_V	1.817	1.00
40_F	46_V	1.722	1.00
22_I	95_V	1.705	1.00
66_G	92_Y	1.654	1.00
19_T	96_T	1.612	1.00
60_A	95_V	1.600	1.00
75_R	82_V	1.600	1.00
19_T	94_K	1.555	1.00
63_E	96_T	1.526	1.00
10_K	23_E	1.459	1.00
7_T	22_I	1.435	1.00
64_K	94_K	1.423	1.00
73_V	86_Q	1.370	1.00
59_T	99_K	1.369	1.00
76_Y	79_K	1.362	1.00
34_T	59_T	1.346	1.00
32_T	98_E	1.321	1.00
37_D	52_T	1.319	1.00
24_K	91_P	1.283	1.00
6_K	52_T	1.264	1.00
5_I	35_F	1.262	1.00
2_Y	13_K	1.232	1.00
74_F	83_H	1.206	1.00
7_T	23_E	1.180	1.00
29_A	64_K	1.173	1.00
35_F	60_A	1.145	0.99
53_V	56_A	1.135	0.99
62_V	93_T	1.132	0.99
21_Y	68_A	1.131	0.99
27_A	31_E	1.109	0.99
48_V	51_P	1.073	0.99
59_T	98_E	1.055	0.99
40_F	48_V	1.050	0.99
19_T	63_E	1.046	0.99
22_I	25_L	1.033	0.99
66_G	94_K	1.026	0.99
73_V	82_V	1.019	0.99
21_Y	66_G	1.017	0.99
74_F	85_K	0.973	0.98
8_G	23_E	0.972	0.98
51_P	55_G	0.961	0.98
20_V	95_V	0.954	0.98
41_V	56_A	0.946	0.98
76_Y	83_H	0.923	0.97
77_K	81_N	0.884	0.97
24_K	65_Q	0.870	0.96
14_V	18_Q	0.857	0.96
32_T	61_K	0.851	0.96
23_E	90_Q	0.835	0.95
5_I	14_V	0.827	0.95
65_Q	93_T	0.818	0.95
7_T	12_I	0.815	0.95
21_Y	64_K	0.807	0.94
12_I	20_V	0.801	0.94
5_I	58_V	0.759	0.92
43_G	46_V	0.755	0.92
29_A	65_Q	0.748	0.92
2_Y	46_V	0.746	0.91
41_V	100_I	0.742	0.91
47_K	53_V	0.741	0.91
41_V	53_V	0.738	0.91
7_T	10_K	0.736	0.91
12_I	23_E	0.734	0.91
73_V	81_N	0.733	0.91
43_G	47_K	0.731	0.91
49_G	52_T	0.719	0.90
71_I	86_Q	0.709	0.89
68_A	92_Y	0.704	0.89
20_V	97_I	0.697	0.88
26_A	65_Q	0.694	0.88
66_G	91_P	0.694	0.88
42_G	45_N	0.693	0.88
72_T	86_Q	0.693	0.88
73_V	83_H	0.691	0.88
23_E	92_Y	0.688	0.88
79_K	82_V	0.675	0.87
21_Y	92_Y	0.669	0.86
23_E	88_H	0.664	0.86
25_L	93_T	0.654	0.85
82_V	86_Q	0.649	0.85
39_L	51_P	0.640	0.84
42_G	46_V	0.632	0.83
20_V	60_A	0.630	0.83
50_N	55_G	0.626	0.83
76_Y	82_V	0.625	0.82
47_K	54_E	0.621	0.82
37_D	51_P	0.616	0.82
39_L	49_G	0.614	0.81
4_I	8_G	0.609	0.81
30_G	61_K	0.608	0.81
75_R	84_K	0.607	0.81
49_G	53_V	0.606	0.80
33_V	95_V	0.605	0.80
64_K	92_Y	0.595	0.79
25_L	33_V	0.593	0.79
76_Y	81_N	0.593	0.79
7_T	25_L	0.581	0.78
36_E	57_T	0.580	0.78
7_T	35_F	0.575	0.77
62_V	65_Q	0.575	0.77
50_N	53_V	0.574	0.77
49_G	55_G	0.573	0.77
72_T	75_R	0.571	0.76
3_A	8_G	0.571	0.76
51_P	54_E	0.568	0.76
8_G	22_I	0.562	0.75
65_Q	91_P	0.561	0.75
68_A	83_H	0.559	0.75
28_E	54_E	0.553	0.74
27_A	33_V	0.553	0.74
12_I	15_E	0.551	0.74
30_G	75_R	0.548	0.74
35_F	81_N	0.546	0.73
2_Y	83_H	0.541	0.73
77_K	80_K	0.539	0.72
72_T	83_H	0.536	0.72
22_I	60_A	0.531	0.71
66_G	86_Q	0.530	0.71
72_T	76_Y	0.527	0.71
38_V	56_A	0.527	0.71
1_M	16_E	0.526	0.70
45_N	54_E	0.525	0.70
47_K	50_N	0.525	0.70
51_P	56_A	0.521	0.70
73_V	88_H	0.517	0.69
4_I	94_K	0.516	0.69
81_N	84_K	0.515	0.69
24_K	66_G	0.514	0.69
67_R	82_V	0.511	0.68
14_V	97_I	0.511	0.68
17_G	98_E	0.509	0.68
63_E	94_K	0.506	0.68
50_N	54_E	0.502	0.67
76_Y	80_K	0.501	0.67
92_Y	95_V	0.501	0.67
2_Y	81_N	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bboT	1	1	100	0.055	Contact Map
4rb6V	1	0.9902	100	0.068	Contact Map
3j3wR	1	1	100	0.068	Contact Map
4tp9R	1	1	100	0.071	Contact Map
3j7yS	1	1	100	0.074	Contact Map
1vw4N	1	1	100	0.074	Contact Map
2zjrO	1	0.9216	100	0.095	Contact Map
2xhaA	1	0.8137	29.5	0.916	Contact Map
2y4xA	1	0.5392	27.5	0.917	Contact Map
4av2M	1	0.5294	15.6	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.