PTFB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTFB - Fructose-specific phosphotransferase enzyme IIB component

UniProt:	P26380	Sequences: MMNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASAVSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSVSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (154)
Sequences:	1637 (1114)
Seq/√Len:	89.8

ECOLI - PTPB2 PTNAB PTPB1
BACSU - PTFB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_S	89_D	4.397	1.00
95_E	133_T	4.042	1.00
67_A	96_A	2.949	1.00
102_T	140_K	2.895	1.00
90_I	103_V	2.702	1.00
91_V	95_E	2.614	1.00
125_E	129_K	2.607	1.00
64_S	68_K	2.541	1.00
91_V	133_T	2.489	1.00
95_E	137_K	2.484	1.00
84_F	90_I	2.361	1.00
91_V	130_A	2.250	1.00
115_R	128_I	2.110	1.00
36_D	92_S	2.088	1.00
63_V	92_S	1.997	1.00
94_I	134_L	1.955	1.00
64_S	92_S	1.940	1.00
117_I	123_V	1.910	1.00
140_K	151_S	1.884	1.00
52_A	58_A	1.854	1.00
84_F	93_L	1.831	1.00
28_A	81_M	1.801	1.00
88_S	130_A	1.769	1.00
5_V	79_T	1.743	1.00
88_S	126_Q	1.706	1.00
27_A	79_T	1.698	1.00
23_I	56_V	1.689	1.00
44_R	85_E	1.685	1.00
129_K	133_T	1.670	1.00
115_R	125_E	1.640	1.00
153_D	156_Q	1.620	1.00
35_S	85_E	1.569	1.00
9_I	131_F	1.562	1.00
39_A	62_S	1.513	1.00
111_E	114_R	1.498	1.00
135_S	155_V	1.448	0.99
133_T	136_D	1.441	0.99
9_I	105_V	1.415	0.99
116_Q	122_S	1.406	0.99
105_V	131_F	1.400	0.99
87_P	108_M	1.387	0.99
102_T	151_S	1.385	0.99
94_I	100_I	1.381	0.99
9_I	87_P	1.367	0.99
42_E	45_K	1.364	0.99
140_K	153_D	1.349	0.99
23_I	31_I	1.345	0.99
11_D	107_G	1.343	0.99
7_A	90_I	1.335	0.99
102_T	142_E	1.325	0.99
30_R	59_S	1.319	0.99
107_G	120_S	1.283	0.99
87_P	130_A	1.259	0.98
5_V	26_H	1.249	0.98
133_T	137_K	1.223	0.98
124_T	127_D	1.175	0.98
64_S	96_A	1.171	0.98
126_Q	129_K	1.171	0.98
114_R	124_T	1.152	0.97
61_V	69_A	1.127	0.97
144_R	147_P	1.125	0.97
92_S	95_E	1.119	0.97
144_R	151_S	1.111	0.97
92_S	96_A	1.111	0.97
132_E	136_D	1.106	0.96
11_D	109_R	1.104	0.96
21_R	147_P	1.099	0.96
87_P	131_F	1.098	0.96
135_S	141_L	1.093	0.96
34_V	66_M	1.087	0.96
30_R	78_V	1.086	0.96
41_D	44_R	1.081	0.96
14_I	48_I	1.054	0.95
73_P	76_E	1.040	0.95
21_R	148_S	1.030	0.95
14_I	58_A	1.028	0.95
65_K	68_K	1.010	0.94
131_F	141_L	1.009	0.94
37_D	41_D	1.007	0.94
88_S	92_S	0.969	0.93
63_V	89_D	0.964	0.93
14_I	33_V	0.955	0.92
91_V	137_K	0.946	0.92
105_V	143_L	0.940	0.92
36_D	63_V	0.938	0.92
108_M	131_F	0.936	0.92
108_M	123_V	0.919	0.91
7_A	100_I	0.914	0.91
126_Q	130_A	0.913	0.90
29_D	79_T	0.907	0.90
86_N	89_D	0.901	0.90
69_A	72_S	0.896	0.90
11_D	14_I	0.892	0.89
34_V	89_D	0.882	0.89
7_A	84_F	0.879	0.89
5_V	28_A	0.875	0.89
67_A	71_H	0.875	0.89
7_A	82_L	0.868	0.88
116_Q	119_K	0.858	0.88
120_S	145_Q	0.853	0.87
118_T	121_V	0.851	0.87
61_V	72_S	0.849	0.87
110_F	113_H	0.848	0.87
40_Q	62_S	0.842	0.87
108_M	121_V	0.839	0.86
38_I	44_R	0.837	0.86
14_I	52_A	0.836	0.86
62_S	65_K	0.831	0.86
110_F	122_S	0.823	0.85
89_D	92_S	0.810	0.84
68_K	71_H	0.807	0.84
19_L	23_I	0.798	0.83
131_F	154_F	0.790	0.83
31_I	52_A	0.790	0.83
94_I	137_K	0.790	0.83
143_L	157_I	0.789	0.83
46_T	50_S	0.784	0.82
6_L	81_M	0.781	0.82
101_K	140_K	0.780	0.82
105_V	141_L	0.774	0.82
135_S	153_D	0.773	0.81
114_R	127_D	0.767	0.81
32_I	69_A	0.754	0.80
21_R	25_V	0.752	0.80
45_K	60_A	0.745	0.79
109_R	114_R	0.745	0.79
70_F	99_P	0.734	0.78
142_E	151_S	0.733	0.78
32_I	84_F	0.724	0.77
36_D	62_S	0.722	0.77
24_K	55_N	0.714	0.76
30_R	80_A	0.712	0.76
6_L	26_H	0.712	0.76
81_M	149_D	0.711	0.76
44_R	48_I	0.710	0.76
38_I	48_I	0.709	0.76
130_A	133_T	0.705	0.75
94_I	103_V	0.704	0.75
13_F	83_L	0.704	0.75
67_A	92_S	0.703	0.75
43_M	47_L	0.700	0.75
68_K	72_S	0.698	0.74
71_H	96_A	0.689	0.73
29_D	78_V	0.680	0.73
99_P	137_K	0.677	0.72
69_A	73_P	0.676	0.72
36_D	89_D	0.672	0.72
24_K	83_L	0.671	0.72
70_F	93_L	0.669	0.71
129_K	132_E	0.658	0.70
115_R	157_I	0.656	0.70
31_I	83_L	0.656	0.70
63_V	96_A	0.651	0.69
59_S	69_A	0.650	0.69
121_V	143_L	0.649	0.69
45_K	49_L	0.648	0.69
49_L	60_A	0.647	0.69
123_V	131_F	0.645	0.69
119_K	149_D	0.644	0.68
38_I	104_N	0.640	0.68
19_L	51_V	0.632	0.67
16_G	106_G	0.628	0.66
47_L	52_A	0.626	0.66
61_V	65_K	0.622	0.66
49_L	58_A	0.619	0.65
34_V	63_V	0.618	0.65
65_K	69_A	0.618	0.65
40_Q	83_L	0.608	0.64
11_D	85_E	0.604	0.63
83_L	122_S	0.597	0.63
105_V	154_F	0.591	0.62
69_A	74_R	0.587	0.61
82_L	90_I	0.587	0.61
56_V	81_M	0.586	0.61
37_D	85_E	0.586	0.61
34_V	93_L	0.585	0.61
19_L	53_P	0.585	0.61
79_T	143_L	0.584	0.61
141_L	157_I	0.582	0.61
114_R	122_S	0.582	0.61
61_V	75_Y	0.582	0.61
62_S	93_L	0.581	0.60
123_V	128_I	0.581	0.60
107_G	145_Q	0.580	0.60
64_S	67_A	0.575	0.60
37_D	44_R	0.575	0.60
126_Q	155_V	0.575	0.60
66_M	70_F	0.572	0.59
100_I	131_F	0.572	0.59
83_L	154_F	0.570	0.59
5_V	27_A	0.568	0.59
113_H	124_T	0.568	0.59
59_S	75_Y	0.565	0.58
94_I	139_V	0.564	0.58
73_P	80_A	0.562	0.58
109_R	120_S	0.561	0.58
24_K	27_A	0.559	0.58
103_V	139_V	0.556	0.57
9_I	30_R	0.552	0.57
17_Q	107_G	0.551	0.56
14_I	28_A	0.548	0.56
18_I	23_I	0.548	0.56
123_V	155_V	0.547	0.56
20_T	122_S	0.546	0.56
24_K	28_A	0.545	0.56
135_S	154_F	0.544	0.56
71_H	99_P	0.542	0.55
25_V	148_S	0.534	0.54
144_R	149_D	0.532	0.54
129_K	136_D	0.531	0.54
93_L	98_V	0.529	0.53
66_M	80_A	0.528	0.53
14_I	83_L	0.524	0.53
37_D	42_E	0.520	0.52
67_A	100_I	0.519	0.52
6_L	20_T	0.518	0.52
72_S	75_Y	0.518	0.52
29_D	96_A	0.515	0.52
118_T	143_L	0.514	0.51
136_D	155_V	0.514	0.51
14_I	107_G	0.513	0.51
20_T	52_A	0.512	0.51
108_M	122_S	0.507	0.50
62_S	66_M	0.506	0.50
59_S	78_V	0.506	0.50
8_R	12_R	0.505	0.50
11_D	108_M	0.504	0.50
93_L	97_G	0.504	0.50
65_K	112_N	0.503	0.50
34_V	67_A	0.502	0.50
32_I	73_P	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bleA	3	0.9877	100	0.035	Contact Map
3lfjA	1	1	100	0.038	Contact Map
1nrzA	2	0.9939	100	0.054	Contact Map
1vsqC	1	1	100	0.055	Contact Map
3p3vA	1	0.9755	100	0.085	Contact Map
3eyeA	1	0.9325	100	0.095	Contact Map
3hl4A	2	0.4908	34.4	0.936	Contact Map
3co8A	2	0.8344	29.3	0.938	Contact Map
3dnfA	2	0.6564	22.9	0.942	Contact Map
2wk1A	2	0.454	21.3	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.