COMGC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COMGC - ComG operon protein 3

UniProt:	P25955	Sequences: MNEKGFTLVEMLIVLFIISILLLITIPNVTKHNQTIQKKGCEGLQNMVKAQMTAFELDHEGQTPSLADLQSEGYVKKDAVCPNGKRIIITGGEVKVEH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (89)
Sequences:	398 (301)
Seq/√Len:	31.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_C	81_C	3.740	1.00
67_A	71_S	2.623	1.00
11_M	14_V	2.501	1.00
15_L	19_S	2.481	0.99
20_I	36_I	2.095	0.98
16_F	20_I	1.978	0.97
45_Q	49_K	1.927	0.97
19_S	40_G	1.906	0.97
3_E	20_I	1.893	0.97
35_T	39_K	1.824	0.96
17_I	90_T	1.758	0.95
26_I	29_V	1.741	0.95
75_V	79_A	1.715	0.94
59_H	72_E	1.705	0.94
14_V	21_L	1.628	0.92
49_K	52_M	1.548	0.90
36_I	40_G	1.545	0.90
40_G	47_M	1.486	0.88
70_Q	80_V	1.483	0.88
9_V	47_M	1.431	0.86
70_Q	77_K	1.425	0.86
37_Q	59_H	1.422	0.86
68_D	71_S	1.417	0.86
64_P	68_D	1.365	0.83
32_H	57_L	1.337	0.82
71_S	85_K	1.323	0.81
68_D	84_G	1.322	0.81
37_Q	56_E	1.308	0.81
23_L	64_P	1.291	0.80
53_T	56_E	1.289	0.80
32_H	79_A	1.285	0.80
55_F	69_L	1.281	0.79
35_T	38_K	1.269	0.79
44_L	52_M	1.247	0.77
13_I	50_A	1.241	0.77
31_K	46_N	1.224	0.76
40_G	44_L	1.188	0.74
15_L	78_D	1.187	0.74
66_L	89_I	1.178	0.73
66_L	75_V	1.150	0.71
62_Q	68_D	1.139	0.71
73_G	78_D	1.131	0.70
16_F	53_T	1.126	0.70
83_N	87_I	1.108	0.68
77_K	81_C	1.096	0.68
13_I	26_I	1.095	0.68
33_N	56_E	1.084	0.67
47_M	79_A	1.083	0.67
60_E	68_D	1.057	0.65
14_V	19_S	1.036	0.63
20_I	40_G	1.036	0.63
44_L	79_A	1.023	0.62
12_L	39_K	1.015	0.62
36_I	48_V	1.014	0.61
49_K	53_T	1.005	0.61
32_H	35_T	1.000	0.60
44_L	75_V	0.990	0.60
5_G	67_A	0.974	0.58
15_L	47_M	0.901	0.52
47_M	54_A	0.894	0.52
19_S	26_I	0.886	0.51
12_L	24_I	0.885	0.51
9_V	84_G	0.884	0.51
9_V	35_T	0.864	0.49
16_F	29_V	0.864	0.49
67_A	91_G	0.855	0.49
36_I	47_M	0.840	0.47
32_H	44_L	0.835	0.47
55_F	75_V	0.832	0.47
66_L	72_E	0.825	0.46
22_L	35_T	0.816	0.45
76_K	79_A	0.802	0.44
88_I	92_G	0.781	0.43
56_E	78_D	0.778	0.42
16_F	36_I	0.774	0.42
31_K	72_E	0.759	0.41
16_F	33_N	0.753	0.40
18_I	36_I	0.746	0.40
53_T	58_D	0.735	0.39
67_A	70_Q	0.731	0.39
48_V	83_N	0.725	0.38
11_M	21_L	0.723	0.38
17_I	36_I	0.720	0.38
26_I	57_L	0.719	0.38
38_K	67_A	0.716	0.38
26_I	75_V	0.710	0.37
25_T	44_L	0.701	0.36
4_K	77_K	0.677	0.35
41_C	84_G	0.675	0.34
22_L	30_T	0.673	0.34
86_R	91_G	0.669	0.34
32_H	53_T	0.644	0.32
18_I	25_T	0.643	0.32
52_M	89_I	0.638	0.32
38_K	59_H	0.633	0.31
40_G	57_L	0.627	0.31
55_F	62_Q	0.627	0.31
22_L	39_K	0.626	0.31
64_P	67_A	0.625	0.31
32_H	76_K	0.609	0.30
14_V	32_H	0.608	0.30
12_L	25_T	0.600	0.29
48_V	82_P	0.600	0.29
37_Q	50_A	0.588	0.28
16_F	75_V	0.588	0.28
12_L	57_L	0.587	0.28
52_M	63_T	0.583	0.28
20_I	33_N	0.581	0.28
18_I	34_Q	0.581	0.28
12_L	75_V	0.573	0.27
12_L	40_G	0.573	0.27
43_G	46_N	0.573	0.27
47_M	53_T	0.567	0.27
7_T	10_E	0.559	0.26
6_F	10_E	0.559	0.26
37_Q	54_A	0.554	0.26
72_E	76_K	0.546	0.26
50_A	56_E	0.545	0.26
50_A	58_D	0.544	0.26
44_L	47_M	0.543	0.25
26_I	54_A	0.538	0.25
32_H	47_M	0.536	0.25
23_L	43_G	0.534	0.25
51_Q	54_A	0.534	0.25
59_H	62_Q	0.533	0.25
12_L	36_I	0.532	0.25
38_K	70_Q	0.532	0.25
17_I	38_K	0.530	0.25
47_M	87_I	0.522	0.24
4_K	67_A	0.522	0.24
5_G	15_L	0.521	0.24
72_E	91_G	0.516	0.24
45_Q	48_V	0.511	0.24
19_S	47_M	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hi2A	1	0.9388	99.1	0.684	Contact Map
3sokA	1	0.949	99	0.695	Contact Map
2m7gA	1	0.6224	98.9	0.707	Contact Map
1oqwA	1	0.9184	98.7	0.725	Contact Map
3g20A	1	0.7755	98.3	0.758	Contact Map
3gn9A	1	0.6939	94.2	0.85	Contact Map
1t92A	2	0.6939	93.7	0.853	Contact Map
2kepA	1	0.7041	93	0.857	Contact Map
4ixjA	1	0.6939	23.5	0.922	Contact Map
3j27B	2	0.2755	22.9	0.922	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.