YQXH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQXH - Uncharacterized protein YqxH

UniProt:	P24811	Sequences: MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKAWKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITENLAQIGVKIPSSITDRLQTIENEKEQSKNNADKAAG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	140 (125)
Sequences:	715 (574)
Seq/√Len:	51.3

BACSU - YQXH YTKC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_S	67_F	5.774	1.00
44_K	108_Q	3.841	1.00
56_A	97_N	2.721	1.00
107_A	124_I	2.446	1.00
73_A	90_T	2.409	1.00
36_I	68_F	2.217	1.00
53_S	101_S	2.199	1.00
41_G	101_S	2.169	1.00
47_K	58_F	2.105	1.00
32_V	75_V	2.091	1.00
25_K	87_T	2.080	1.00
33_L	95_I	1.982	1.00
115_S	119_D	1.857	0.99
99_G	121_L	1.853	0.99
37_D	41_G	1.803	0.99
59_G	101_S	1.740	0.99
63_K	98_E	1.740	0.99
48_F	108_Q	1.705	0.99
37_D	101_S	1.682	0.98
66_N	94_Y	1.671	0.98
60_Y	97_N	1.648	0.98
41_G	53_S	1.617	0.98
119_D	126_N	1.614	0.98
107_A	113_I	1.606	0.98
42_V	100_L	1.574	0.98
41_G	59_G	1.475	0.96
30_L	70_V	1.436	0.96
65_L	106_L	1.435	0.96
49_K	123_T	1.434	0.96
47_K	110_G	1.363	0.95
99_G	123_T	1.357	0.94
101_S	104_E	1.356	0.94
107_A	121_L	1.338	0.94
51_L	100_L	1.296	0.93
102_I	109_I	1.295	0.93
53_S	59_G	1.277	0.92
7_F	11_E	1.263	0.92
37_D	59_G	1.250	0.92
106_L	111_V	1.247	0.91
26_Y	91_V	1.238	0.91
64_L	69_A	1.236	0.91
11_E	18_V	1.230	0.91
37_D	53_S	1.202	0.90
64_L	71_I	1.180	0.89
47_K	109_I	1.170	0.89
56_A	60_Y	1.168	0.88
53_S	104_E	1.163	0.88
60_Y	71_I	1.163	0.88
12_T	15_L	1.150	0.88
70_V	91_V	1.147	0.88
46_W	120_R	1.133	0.87
41_G	104_E	1.129	0.87
29_L	79_V	1.124	0.87
37_D	104_E	1.120	0.86
13_L	126_N	1.110	0.86
85_V	125_E	1.063	0.83
12_T	19_Y	1.060	0.83
118_T	122_Q	1.050	0.82
29_L	75_V	1.044	0.82
28_D	32_V	1.037	0.82
45_A	49_K	1.032	0.81
52_R	122_Q	1.026	0.81
20_L	71_I	1.022	0.81
29_L	95_I	1.018	0.80
31_L	68_F	1.017	0.80
33_L	76_I	1.002	0.79
81_N	99_G	0.976	0.78
40_T	105_N	0.971	0.77
93_F	112_K	0.962	0.77
45_A	59_G	0.958	0.76
18_V	92_L	0.936	0.75
113_I	118_T	0.935	0.75
36_I	102_I	0.910	0.72
59_G	104_E	0.908	0.72
38_V	44_K	0.898	0.71
9_N	12_T	0.893	0.71
79_V	95_I	0.890	0.71
13_L	20_L	0.885	0.70
59_G	105_N	0.885	0.70
69_A	90_T	0.885	0.70
96_A	99_G	0.884	0.70
74_N	91_V	0.880	0.70
16_A	19_Y	0.877	0.70
38_V	58_F	0.871	0.69
115_S	130_Q	0.870	0.69
39_L	43_I	0.850	0.67
103_T	113_I	0.846	0.67
10_F	126_N	0.838	0.66
101_S	105_N	0.838	0.66
57_W	62_R	0.828	0.65
103_T	117_I	0.814	0.64
38_V	55_S	0.806	0.63
57_W	66_N	0.799	0.62
58_F	62_R	0.798	0.62
65_L	125_E	0.792	0.62
51_L	56_A	0.788	0.61
8_I	12_T	0.787	0.61
60_Y	64_L	0.783	0.61
11_E	92_L	0.776	0.60
15_L	18_V	0.771	0.60
69_A	94_Y	0.763	0.59
113_I	131_S	0.756	0.58
115_S	118_T	0.752	0.58
103_T	121_L	0.748	0.57
46_W	49_K	0.748	0.57
45_A	104_E	0.747	0.57
30_L	100_L	0.747	0.57
62_R	72_L	0.745	0.57
14_D	18_V	0.742	0.57
43_I	61_V	0.742	0.57
26_Y	86_L	0.740	0.57
23_G	87_T	0.740	0.57
8_I	13_L	0.734	0.56
63_K	77_D	0.733	0.56
29_L	33_L	0.732	0.56
38_V	97_N	0.722	0.55
89_G	92_L	0.718	0.54
76_I	99_G	0.716	0.54
33_L	99_G	0.713	0.54
95_I	99_G	0.707	0.53
12_T	27_L	0.704	0.53
112_K	118_T	0.703	0.53
70_V	129_E	0.702	0.53
64_L	70_V	0.696	0.52
52_R	62_R	0.694	0.52
14_D	56_A	0.693	0.52
42_V	46_W	0.692	0.52
33_L	72_L	0.685	0.51
77_D	98_E	0.685	0.51
38_V	56_A	0.681	0.50
65_L	109_I	0.681	0.50
21_F	87_T	0.677	0.50
19_Y	28_D	0.677	0.50
92_L	96_A	0.676	0.50
62_R	65_L	0.675	0.50
58_F	106_L	0.673	0.50
38_V	42_V	0.665	0.49
17_R	21_F	0.665	0.49
27_L	31_L	0.660	0.48
18_V	21_F	0.657	0.48
106_L	113_I	0.654	0.48
62_R	66_N	0.644	0.47
37_D	105_N	0.643	0.46
47_K	61_V	0.639	0.46
34_S	54_R	0.639	0.46
34_S	40_T	0.636	0.46
35_I	67_F	0.634	0.46
48_F	115_S	0.631	0.45
9_N	19_Y	0.629	0.45
69_A	106_L	0.624	0.45
40_T	55_S	0.612	0.43
44_K	48_F	0.610	0.43
26_Y	92_L	0.607	0.43
24_V	28_D	0.603	0.42
44_K	95_I	0.601	0.42
27_L	119_D	0.599	0.42
116_S	128_K	0.597	0.42
47_K	112_K	0.579	0.40
27_L	61_V	0.576	0.40
64_L	76_I	0.571	0.39
72_L	99_G	0.565	0.39
72_L	85_V	0.563	0.38
53_S	105_N	0.561	0.38
42_V	73_A	0.557	0.38
19_Y	61_V	0.553	0.37
20_L	32_V	0.551	0.37
8_I	68_F	0.545	0.37
38_V	87_T	0.540	0.36
44_K	60_Y	0.539	0.36
54_R	122_Q	0.537	0.36
56_A	105_N	0.536	0.36
84_G	88_F	0.534	0.36
7_F	60_Y	0.533	0.35
8_I	117_I	0.532	0.35
95_I	102_I	0.532	0.35
41_G	105_N	0.531	0.35
52_R	60_Y	0.530	0.35
50_K	122_Q	0.527	0.35
45_A	101_S	0.522	0.34
31_L	78_T	0.522	0.34
12_T	16_A	0.521	0.34
12_T	48_F	0.521	0.34
80_L	84_G	0.515	0.34
115_S	129_E	0.512	0.33
44_K	61_V	0.508	0.33
57_W	91_V	0.503	0.33
57_W	97_N	0.501	0.32
94_Y	106_L	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2htjA	1	0.3857	4.4	0.951	Contact Map
2i88A	1	0.3643	3.8	0.953	Contact Map
4qicB	2	0.3214	3.8	0.953	Contact Map
2kv5A	1	0.2357	3.8	0.953	Contact Map
4wzxA	1	0.2857	3.7	0.953	Contact Map
2olsA	2	0.4429	3.4	0.954	Contact Map
3bo0B	1	0.2643	3.3	0.954	Contact Map
4je3A	1	0.4	3	0.955	Contact Map
2z5iI	2	0.1929	3	0.955	Contact Map
2kpoA	1	0.3714	2.9	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.