FLIE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIE - Flagellar hook-basal body complex protein FliE

UniProt:	P24502	Sequences: MINAISPFQVQNTQNTQNATNQVNNSQKTDSSNQTSFSELLKNSISSLNESQVASDNMTNALAAGKDVNLDEVMIAAQKASISLTAATEFRNKAVEAYQEIMRMQM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	106 (93)
Sequences:	1125 (888)
Seq/√Len:	92.0

ECOLI - FLIE
BACSU - FLIE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_A	66_K	4.018	1.00
51_S	83_S	3.534	1.00
48_L	87_A	3.454	1.00
69_N	72_E	3.289	1.00
62_L	73_V	3.130	1.00
42_K	46_S	2.918	1.00
49_N	53_V	2.717	1.00
83_S	87_A	2.636	1.00
96_E	99_Q	2.625	1.00
45_I	87_A	2.623	1.00
60_N	64_A	2.108	1.00
47_S	50_E	2.078	1.00
85_T	89_E	2.008	1.00
14_Q	17_Q	1.621	1.00
59_T	77_A	1.608	1.00
99_Q	103_R	1.604	1.00
68_V	72_E	1.582	1.00
100_E	103_R	1.556	1.00
16_T	20_T	1.474	1.00
57_N	61_A	1.447	0.99
54_A	57_N	1.437	0.99
72_E	79_K	1.321	0.99
43_N	96_E	1.319	0.99
58_M	61_A	1.318	0.99
39_E	42_K	1.309	0.99
57_N	60_N	1.262	0.99
58_M	76_A	1.236	0.98
54_A	58_M	1.234	0.98
36_S	39_E	1.224	0.98
53_V	57_N	1.198	0.98
58_M	68_V	1.121	0.97
47_S	51_S	1.111	0.97
63_A	105_Q	1.098	0.97
41_L	44_S	1.085	0.96
30_D	34_Q	1.064	0.96
55_S	59_T	1.050	0.96
18_N	22_Q	1.041	0.95
50_E	54_A	1.000	0.94
15_N	18_N	0.997	0.94
38_S	42_K	0.989	0.94
72_E	93_K	0.984	0.94
17_Q	20_T	0.946	0.92
70_L	81_S	0.942	0.92
97_A	101_I	0.920	0.91
73_V	77_A	0.913	0.91
45_I	89_E	0.896	0.90
62_L	68_V	0.892	0.90
55_S	73_V	0.887	0.90
14_Q	18_N	0.886	0.90
85_T	88_T	0.880	0.89
49_N	73_V	0.880	0.89
54_A	76_A	0.857	0.88
19_A	93_K	0.852	0.88
71_D	88_T	0.846	0.87
20_T	101_I	0.845	0.87
39_E	43_N	0.837	0.87
71_D	75_I	0.837	0.87
56_D	105_Q	0.836	0.87
80_A	83_S	0.820	0.86
55_S	80_A	0.809	0.85
17_Q	93_K	0.808	0.85
44_S	88_T	0.784	0.83
28_K	31_S	0.782	0.83
96_E	100_E	0.782	0.83
42_K	97_A	0.781	0.83
91_R	99_Q	0.776	0.83
70_L	82_I	0.772	0.82
58_M	72_E	0.771	0.82
79_K	102_M	0.765	0.82
33_N	54_A	0.764	0.82
14_Q	21_N	0.763	0.81
59_T	103_R	0.762	0.81
40_L	87_A	0.756	0.81
85_T	101_I	0.752	0.81
49_N	52_Q	0.750	0.80
84_L	89_E	0.741	0.80
37_F	41_L	0.737	0.79
30_D	33_N	0.726	0.78
64_A	68_V	0.724	0.78
26_S	29_T	0.717	0.77
16_T	19_A	0.713	0.77
22_Q	25_N	0.710	0.77
38_S	78_Q	0.709	0.76
23_V	26_S	0.705	0.76
95_V	98_Y	0.701	0.76
70_L	99_Q	0.696	0.75
55_S	77_A	0.690	0.75
67_D	72_E	0.671	0.72
99_Q	105_Q	0.671	0.72
38_S	73_V	0.669	0.72
96_E	105_Q	0.664	0.72
55_S	76_A	0.663	0.72
43_N	46_S	0.659	0.71
89_E	92_N	0.658	0.71
40_L	86_A	0.658	0.71
81_S	85_T	0.653	0.70
83_S	89_E	0.651	0.70
26_S	30_D	0.641	0.69
14_Q	79_K	0.637	0.69
44_S	78_Q	0.629	0.68
52_Q	84_L	0.629	0.68
59_T	73_V	0.625	0.67
24_N	43_N	0.621	0.67
84_L	88_T	0.620	0.66
71_D	86_A	0.620	0.66
56_D	60_N	0.616	0.66
33_N	36_S	0.610	0.65
73_V	99_Q	0.607	0.65
81_S	95_V	0.606	0.65
82_I	86_A	0.597	0.64
89_E	100_E	0.595	0.63
48_L	84_L	0.591	0.63
40_L	78_Q	0.581	0.61
67_D	73_V	0.570	0.60
29_T	32_S	0.570	0.60
26_S	32_S	0.565	0.59
27_Q	30_D	0.560	0.59
84_L	87_A	0.559	0.59
63_A	71_D	0.551	0.57
55_S	83_S	0.550	0.57
20_T	23_V	0.548	0.57
81_S	87_A	0.542	0.56
55_S	86_A	0.540	0.56
77_A	101_I	0.539	0.56
24_N	80_A	0.538	0.56
59_T	105_Q	0.536	0.55
77_A	81_S	0.535	0.55
18_N	21_N	0.535	0.55
27_Q	32_S	0.533	0.55
15_N	20_T	0.529	0.54
53_V	93_K	0.528	0.54
89_E	96_E	0.519	0.53
21_N	25_N	0.518	0.53
51_S	101_I	0.516	0.53
72_E	88_T	0.515	0.53
69_N	73_V	0.508	0.52
27_Q	50_E	0.507	0.51
57_N	66_K	0.505	0.51
49_N	95_V	0.501	0.51
62_L	70_L	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rp3B	1	0.6981	8.8	0.927	Contact Map
1vw1A	5	0.9528	4.9	0.935	Contact Map
3a69A	3	0.8396	3.6	0.939	Contact Map
2ca5A	1	0.6038	3.1	0.941	Contact Map
4ut1A	1	0.9623	2.8	0.943	Contact Map
4um2A	1	0.5094	2.5	0.944	Contact Map
2g0uA	1	0.7925	2.3	0.945	Contact Map
4n78D	1	0.783	2.1	0.946	Contact Map
3l8rA	3	0.934	1.9	0.947	Contact Map
3b77A	4	0.434	1.9	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.