FLGC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLGC - Flagellar basal-body rod protein FlgC

UniProt:	P24501	Sequences: MTAFHSLNVSASALTAQRVRMDVVSSNLANMDTTRAKQVNGEWVPYRRKMVSLQSKGESFSSILNSQMSGSGNAGNGVKVSKITEDDSDFNLVYDPTDPDANAEGYVQKPNVDPLKEMVDLVSSTRSYEANVTAMNATKGMLMKALEIGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (132)
Sequences:	1948 (1320)
Seq/√Len:	114.9

ECOLI - FLGC FLGF FLGG
BACSU - FLGC FLGG FLHP FLHO

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
92_L	108_Q	4.301	1.00
144_K	147_E	3.679	1.00
113_D	116_K	3.567	1.00
90_F	108_Q	3.050	1.00
92_L	102_N	2.793	1.00
102_N	108_Q	2.706	1.00
36_A	44_V	2.637	1.00
54_Q	81_S	2.519	1.00
47_R	90_F	2.382	1.00
34_T	100_D	2.335	1.00
17_Q	20_R	2.281	1.00
28_L	114_P	2.207	1.00
10_S	134_A	2.170	1.00
23_V	51_V	2.150	1.00
147_E	150_K	2.098	1.00
95_D	109_K	2.019	1.00
92_L	104_E	1.951	1.00
16_A	53_L	1.893	1.00
54_Q	79_K	1.864	1.00
35_R	100_D	1.778	1.00
19_V	83_I	1.741	1.00
5_H	8_N	1.740	1.00
21_M	121_L	1.722	1.00
35_R	43_W	1.721	1.00
133_T	136_N	1.705	1.00
26_S	49_K	1.704	1.00
6_S	138_T	1.648	1.00
50_M	120_D	1.622	1.00
45_P	90_F	1.609	1.00
95_D	98_D	1.605	1.00
94_Y	106_Y	1.589	1.00
50_M	84_T	1.584	1.00
118_M	121_L	1.448	1.00
10_S	13_A	1.444	1.00
92_L	106_Y	1.408	1.00
47_R	85_E	1.406	1.00
24_V	121_L	1.397	1.00
10_S	135_M	1.370	1.00
17_Q	127_S	1.352	1.00
49_K	85_E	1.270	0.99
126_R	129_E	1.213	0.99
36_A	43_W	1.192	0.99
44_V	47_R	1.168	0.99
17_Q	123_S	1.164	0.99
56_K	79_K	1.161	0.99
93_V	109_K	1.139	0.99
98_D	103_A	1.113	0.98
136_N	149_G	1.106	0.98
52_S	84_T	1.105	0.98
48_R	86_D	1.105	0.98
46_Y	49_K	1.089	0.98
7_L	135_M	1.077	0.98
37_K	43_W	1.065	0.98
123_S	127_S	1.061	0.98
88_S	116_K	1.032	0.98
90_F	112_V	1.029	0.97
140_G	143_M	1.026	0.97
14_L	21_M	1.006	0.97
125_T	137_A	1.005	0.97
13_A	28_L	1.003	0.97
44_V	108_Q	0.994	0.97
28_L	134_A	0.987	0.97
116_K	120_D	0.984	0.97
28_L	56_K	0.979	0.97
7_L	142_L	0.977	0.97
12_S	77_G	0.968	0.96
133_T	139_K	0.960	0.96
3_A	138_T	0.959	0.96
3_A	6_S	0.952	0.96
14_L	135_M	0.943	0.96
96_P	101_A	0.929	0.95
18_R	22_D	0.917	0.95
4_F	142_L	0.914	0.95
129_E	133_T	0.906	0.95
20_R	123_S	0.903	0.95
137_A	141_M	0.892	0.94
96_P	99_P	0.888	0.94
91_N	109_K	0.883	0.94
135_M	138_T	0.878	0.94
129_E	147_E	0.873	0.94
117_E	141_M	0.871	0.94
114_P	133_T	0.870	0.93
19_V	51_V	0.863	0.93
136_N	139_K	0.860	0.93
55_S	76_N	0.855	0.93
70_G	73_N	0.851	0.93
10_S	14_L	0.836	0.92
142_L	145_A	0.833	0.92
7_L	148_I	0.830	0.92
135_M	148_I	0.827	0.92
45_P	110_P	0.807	0.91
132_V	136_N	0.805	0.91
17_Q	32_D	0.798	0.90
23_V	26_S	0.793	0.90
23_V	83_I	0.791	0.90
48_R	117_E	0.788	0.90
136_N	140_G	0.784	0.89
138_T	142_L	0.782	0.89
6_S	134_A	0.776	0.89
36_A	42_E	0.776	0.89
36_A	107_V	0.767	0.88
93_V	119_V	0.767	0.88
115_L	122_V	0.766	0.88
13_A	131_N	0.765	0.88
11_A	129_E	0.763	0.88
37_K	42_E	0.763	0.88
14_L	119_V	0.759	0.88
33_T	55_S	0.755	0.88
19_V	22_D	0.753	0.87
98_D	101_A	0.742	0.87
94_Y	99_P	0.717	0.85
53_L	57_G	0.710	0.84
78_V	101_A	0.710	0.84
10_S	138_T	0.708	0.84
81_S	84_T	0.704	0.84
128_Y	145_A	0.699	0.83
128_Y	142_L	0.697	0.83
3_A	142_L	0.692	0.83
53_L	78_V	0.691	0.82
118_M	122_V	0.685	0.82
122_V	138_T	0.685	0.82
22_D	26_S	0.684	0.82
129_E	140_G	0.682	0.82
94_Y	101_A	0.678	0.81
45_P	108_Q	0.674	0.81
12_S	16_A	0.671	0.81
36_A	45_P	0.669	0.80
143_M	147_E	0.669	0.80
18_R	35_R	0.668	0.80
6_S	9_V	0.666	0.80
37_K	44_V	0.665	0.80
143_M	150_K	0.663	0.80
86_D	111_N	0.656	0.79
26_S	36_A	0.651	0.79
21_M	114_P	0.641	0.78
17_Q	124_S	0.639	0.77
89_D	114_P	0.635	0.77
20_R	120_D	0.628	0.76
9_V	76_N	0.627	0.76
13_A	17_Q	0.621	0.75
54_Q	82_K	0.615	0.75
46_Y	120_D	0.613	0.74
95_D	107_V	0.605	0.73
136_N	144_K	0.605	0.73
47_R	87_D	0.604	0.73
13_A	26_S	0.599	0.73
124_S	130_A	0.592	0.72
145_A	148_I	0.592	0.72
122_V	126_R	0.590	0.72
99_P	102_N	0.587	0.71
34_T	109_K	0.585	0.71
76_N	79_K	0.584	0.71
32_D	110_P	0.580	0.70
30_N	33_T	0.579	0.70
21_M	141_M	0.568	0.69
101_A	105_G	0.567	0.69
79_K	103_A	0.567	0.69
13_A	137_A	0.567	0.69
18_R	100_D	0.566	0.68
140_G	144_K	0.566	0.68
25_S	138_T	0.564	0.68
52_S	81_S	0.561	0.68
50_M	116_K	0.557	0.67
133_T	143_M	0.555	0.67
8_N	28_L	0.554	0.67
54_Q	78_V	0.551	0.66
35_R	139_K	0.550	0.66
115_L	119_V	0.545	0.66
57_G	74_A	0.544	0.65
23_V	75_G	0.544	0.65
7_L	129_E	0.544	0.65
129_E	144_K	0.537	0.64
145_A	149_G	0.537	0.64
8_N	129_E	0.537	0.64
71_S	74_A	0.535	0.64
70_G	76_N	0.535	0.64
102_N	106_Y	0.533	0.64
3_A	79_K	0.530	0.63
9_V	137_A	0.526	0.63
80_V	83_I	0.526	0.63
56_K	71_S	0.525	0.63
15_T	132_V	0.524	0.63
4_F	135_M	0.520	0.62
125_T	142_L	0.520	0.62
18_R	129_E	0.518	0.62
96_P	102_N	0.517	0.61
121_L	125_T	0.517	0.61
14_L	17_Q	0.516	0.61
15_T	19_V	0.515	0.61
5_H	37_K	0.512	0.61
5_H	123_S	0.507	0.60
16_A	78_V	0.507	0.60
32_D	128_Y	0.505	0.60
44_V	103_A	0.505	0.60
122_V	125_T	0.505	0.60
10_S	131_N	0.502	0.59
52_S	94_Y	0.501	0.59
7_L	138_T	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3a69A	3	0.7333	99.9	0.427	Contact Map
4ut1A	1	0.5733	99.4	0.654	Contact Map
1wlgA	2	0.6933	85.8	0.885	Contact Map
1oryB	2	0.2667	15.8	0.932	Contact Map
1ucuA	1	0.7133	14.8	0.933	Contact Map
2d4yA	1	0.6	4.6	0.947	Contact Map
2d4xA	1	0.34	2.6	0.953	Contact Map
7ceiB	1	0	2.4	0.954	Contact Map
2qt7A	3	0.3333	2.3	0.955	Contact Map
3k1iC	1	0.1667	2.1	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.