BOFA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BOFA - Sigma-K factor-processing regulatory protein BofA

UniProt:	P24282	Sequences: MEPIFIIGIILGLVILLFLSGSAAKPLKWIGITAVKFVAGALLLVCVNMFGGSLGIHVPINLVTTAISGILGIPGIAALVVIKQFII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	87 (87)
Sequences:	124 (100)
Seq/√Len:	10.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_T	70_I	3.490	0.98
47_V	83_K	2.812	0.92
14_V	82_I	2.809	0.91
40_G	69_G	2.574	0.87
19_L	65_T	2.569	0.87
3_P	21_G	2.446	0.84
56_I	83_K	2.272	0.80
7_I	68_S	1.931	0.67
50_F	85_F	1.816	0.62
43_L	47_V	1.805	0.62
51_G	57_H	1.777	0.60
78_A	82_I	1.742	0.59
22_S	26_P	1.731	0.58
22_S	25_K	1.715	0.57
23_A	32_I	1.671	0.55
63_V	86_I	1.540	0.49
10_I	15_I	1.529	0.49
63_V	85_F	1.510	0.48
14_V	17_L	1.440	0.45
73_I	87_I	1.388	0.42
41_A	65_T	1.352	0.40
34_A	56_I	1.352	0.40
16_L	25_K	1.336	0.40
18_F	21_G	1.298	0.38
4_I	8_G	1.297	0.38
33_T	87_I	1.267	0.37
77_A	82_I	1.229	0.35
22_S	39_A	1.222	0.35
41_A	69_G	1.210	0.34
31_G	44_L	1.179	0.33
12_G	19_L	1.165	0.32
46_C	50_F	1.159	0.32
56_I	80_V	1.147	0.32
49_M	86_I	1.133	0.31
20_S	24_A	1.127	0.31
66_A	85_F	1.079	0.29
6_I	10_I	1.073	0.29
14_V	18_F	1.045	0.28
33_T	37_F	1.041	0.27
9_I	30_I	1.033	0.27
29_W	42_L	1.014	0.26
50_F	65_T	1.009	0.26
30_I	56_I	0.996	0.26
63_V	84_Q	0.993	0.26
19_L	41_A	0.985	0.25
43_L	76_I	0.973	0.25
31_G	74_P	0.960	0.24
81_V	86_I	0.959	0.24
80_V	83_K	0.954	0.24
7_I	38_V	0.950	0.24
2_E	33_T	0.949	0.24
5_F	30_I	0.945	0.24
36_K	55_G	0.937	0.24
84_Q	87_I	0.936	0.24
63_V	83_K	0.932	0.23
25_K	28_K	0.898	0.22
16_L	87_I	0.897	0.22
42_L	49_M	0.842	0.21
14_V	78_A	0.838	0.20
58_V	83_K	0.838	0.20
52_G	56_I	0.836	0.20
33_T	54_L	0.831	0.20
17_L	36_K	0.828	0.20
29_W	77_A	0.823	0.20
23_A	46_C	0.823	0.20
18_F	46_C	0.820	0.20
9_I	12_G	0.814	0.20
5_F	9_I	0.814	0.20
51_G	69_G	0.811	0.20
35_V	52_G	0.805	0.19
30_I	33_T	0.805	0.19
22_S	76_I	0.805	0.19
21_G	42_L	0.795	0.19
5_F	20_S	0.791	0.19
29_W	70_I	0.780	0.19
36_K	73_I	0.772	0.18
49_M	81_V	0.771	0.18
43_L	65_T	0.767	0.18
13_L	63_V	0.754	0.18
9_I	38_V	0.753	0.18
18_F	28_K	0.748	0.18
10_I	42_L	0.744	0.18
77_A	81_V	0.742	0.18
2_E	5_F	0.726	0.17
55_G	80_V	0.724	0.17
53_S	85_F	0.723	0.17
15_I	66_A	0.720	0.17
68_S	76_I	0.715	0.17
55_G	81_V	0.709	0.17
1_M	86_I	0.696	0.16
31_G	83_K	0.690	0.16
15_I	38_V	0.687	0.16
4_I	49_M	0.682	0.16
8_G	27_L	0.677	0.16
4_I	19_L	0.669	0.16
52_G	65_T	0.661	0.15
11_L	55_G	0.658	0.15
16_L	20_S	0.657	0.15
46_C	85_F	0.648	0.15
19_L	28_K	0.639	0.15
24_A	42_L	0.633	0.15
18_F	72_G	0.620	0.14
36_K	50_F	0.612	0.14
6_I	24_A	0.611	0.14
19_L	24_A	0.601	0.14
41_A	76_I	0.600	0.14
58_V	68_S	0.594	0.14
21_G	72_G	0.594	0.14
36_K	72_G	0.592	0.14
16_L	81_V	0.588	0.14
27_L	37_F	0.587	0.14
14_V	23_A	0.582	0.14
41_A	78_A	0.582	0.14
6_I	62_L	0.576	0.13
81_V	85_F	0.574	0.13
54_L	68_S	0.569	0.13
55_G	83_K	0.558	0.13
78_A	81_V	0.556	0.13
27_L	34_A	0.549	0.13
38_V	74_P	0.547	0.13
63_V	66_A	0.545	0.13
8_G	53_S	0.543	0.13
12_G	63_V	0.537	0.13
50_F	55_G	0.536	0.13
49_M	52_G	0.534	0.13
24_A	50_F	0.520	0.12
65_T	73_I	0.514	0.12
19_L	52_G	0.513	0.12
70_I	77_A	0.502	0.12
50_F	87_I	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wwbC	1	0.3333	4.3	0.934	Contact Map
2ww9C	1	0.2299	3.3	0.938	Contact Map
4mt1A	3	0.9655	2.9	0.94	Contact Map
4k0jA	3	0.8506	2.4	0.942	Contact Map
3w9iA	3	0.8736	2	0.945	Contact Map
1ji6A	1	0.3793	1.7	0.947	Contact Map
3ne5A	3	0.8736	1.6	0.948	Contact Map
3b5dA	2	0.5287	1.3	0.95	Contact Map
4dveA	3	0.977	1.2	0.951	Contact Map
4dx5A	3	0.8736	1.2	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.