RECR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RECR - Recombination protein RecR

UniProt:	P24277	Sequences: MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	198 (192)
Sequences:	2898 (1607)
Seq/√Len:	116.0

ECOLI - RECR
BACSU - RECR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_K	103_Q	4.653	1.00
58_S	67_D	4.504	1.00
80_S	137_T	3.536	1.00
49_N	53_N	3.354	1.00
20_I	28_L	3.318	1.00
123_K	126_E	3.217	1.00
131_L	160_L	2.734	1.00
139_V	160_L	2.674	1.00
45_K	48_V	2.634	1.00
174_L	183_A	2.610	1.00
143_T	153_A	2.604	1.00
58_S	68_P	2.597	1.00
14_F	43_F	2.569	1.00
82_I	136_V	2.548	1.00
112_S	115_D	2.515	1.00
24_T	28_L	2.405	1.00
14_F	29_A	2.399	1.00
40_V	47_L	2.382	1.00
14_F	32_V	2.322	1.00
61_G	126_E	2.313	1.00
37_E	52_R	2.256	1.00
59_V	68_P	2.241	1.00
55_T	67_D	2.199	1.00
45_K	49_N	2.043	1.00
61_G	123_K	2.034	1.00
41_L	52_R	1.883	1.00
78_D	81_V	1.810	1.00
66_Q	73_E	1.794	1.00
41_L	48_V	1.785	1.00
40_V	51_K	1.773	1.00
129_K	132_Q	1.761	1.00
118_G	121_D	1.749	1.00
124_I	156_I	1.715	1.00
37_E	41_L	1.678	1.00
124_I	128_L	1.670	1.00
44_A	48_V	1.623	1.00
62_H	91_V	1.591	1.00
36_K	39_V	1.588	1.00
78_D	137_T	1.548	1.00
105_H	130_R	1.538	1.00
96_K	185_E	1.532	1.00
168_S	195_R	1.475	1.00
9_K	49_N	1.467	1.00
132_Q	163_S	1.447	1.00
129_K	133_D	1.413	1.00
56_Y	108_H	1.412	1.00
110_A	144_N	1.374	1.00
140_I	192_L	1.367	1.00
86_Q	110_A	1.349	1.00
8_S	12_D	1.346	1.00
108_H	123_K	1.324	1.00
190_K	193_E	1.323	1.00
6_P	65_D	1.319	1.00
110_A	146_N	1.312	1.00
41_L	45_K	1.306	1.00
95_E	104_Y	1.272	0.99
59_V	134_D	1.263	0.99
125_P	129_K	1.261	0.99
94_M	192_L	1.229	0.99
122_I	156_I	1.228	0.99
172_H	190_K	1.215	0.99
7_I	54_L	1.197	0.99
13_S	16_K	1.191	0.99
175_P	178_G	1.188	0.99
10_L	50_A	1.178	0.99
13_S	42_D	1.170	0.99
59_V	133_D	1.164	0.99
71_I	91_V	1.144	0.99
54_L	63_I	1.137	0.99
100_Y	103_Q	1.134	0.99
64_T	68_P	1.133	0.99
11_I	26_V	1.125	0.99
16_K	39_V	1.108	0.98
9_K	42_D	1.099	0.98
97_M	189_S	1.096	0.98
48_V	52_R	1.094	0.98
32_V	35_M	1.092	0.98
128_L	159_L	1.084	0.98
131_L	135_Q	1.084	0.98
159_L	162_P	1.076	0.98
60_C	72_C	1.038	0.98
37_E	51_K	1.037	0.98
143_T	169_R	1.036	0.98
160_L	167_L	1.035	0.98
91_V	106_V	1.032	0.98
40_V	43_F	1.029	0.98
79_K	135_Q	1.026	0.97
74_D	101_N	1.022	0.97
184_D	187_T	1.022	0.97
22_P	178_G	1.020	0.97
5_E	9_K	1.007	0.97
34_G	87_D	0.993	0.97
80_S	133_D	0.979	0.97
110_A	143_T	0.971	0.97
62_H	88_P	0.969	0.96
59_V	79_K	0.967	0.96
38_D	41_L	0.966	0.96
141_L	167_L	0.958	0.96
59_V	130_R	0.942	0.96
131_L	165_I	0.939	0.96
83_C	102_G	0.935	0.96
13_S	46_A	0.920	0.95
81_V	137_T	0.919	0.95
88_P	108_H	0.918	0.95
30_F	194_G	0.917	0.95
150_E	154_M	0.912	0.95
88_P	91_V	0.908	0.95
59_V	105_H	0.899	0.95
30_F	92_I	0.893	0.94
128_L	132_Q	0.891	0.94
53_N	65_D	0.888	0.94
39_V	42_D	0.884	0.94
17_L	28_L	0.862	0.93
11_I	140_I	0.860	0.93
69_C	72_C	0.854	0.93
55_T	64_T	0.853	0.93
6_P	46_A	0.848	0.93
7_I	29_A	0.848	0.93
90_D	178_G	0.845	0.93
60_C	69_C	0.845	0.93
66_Q	70_Y	0.841	0.92
71_I	77_R	0.837	0.92
131_L	156_I	0.835	0.92
83_C	100_Y	0.835	0.92
6_P	53_N	0.832	0.92
68_P	73_E	0.817	0.91
55_T	58_S	0.816	0.91
190_K	194_G	0.813	0.91
124_I	159_L	0.806	0.91
29_A	50_A	0.801	0.91
119_P	155_Y	0.798	0.90
82_I	133_D	0.793	0.90
35_M	39_V	0.789	0.90
119_P	122_I	0.785	0.90
111_I	147_I	0.782	0.89
103_Q	130_R	0.768	0.89
75_T	79_K	0.766	0.88
45_K	73_E	0.764	0.88
13_S	39_V	0.764	0.88
179_D	182_Y	0.763	0.88
20_I	25_A	0.763	0.88
30_F	88_P	0.762	0.88
41_L	44_A	0.761	0.88
128_L	160_L	0.761	0.88
61_G	108_H	0.760	0.88
175_P	187_T	0.759	0.88
22_P	174_L	0.755	0.88
111_I	151_A	0.750	0.87
97_M	192_L	0.749	0.87
147_I	172_H	0.748	0.87
141_L	153_A	0.745	0.87
6_P	49_N	0.744	0.87
79_K	134_D	0.739	0.87
40_V	44_A	0.735	0.86
55_T	68_P	0.730	0.86
105_H	122_I	0.728	0.86
41_L	51_K	0.726	0.86
105_H	126_E	0.725	0.86
6_P	54_L	0.718	0.85
154_M	186_V	0.715	0.85
128_L	131_L	0.711	0.84
132_Q	162_P	0.711	0.84
132_Q	135_Q	0.706	0.84
61_G	172_H	0.703	0.84
81_V	100_Y	0.702	0.84
76_R	101_N	0.702	0.84
89_K	111_I	0.702	0.84
78_D	103_Q	0.695	0.83
138_E	195_R	0.695	0.83
110_A	117_I	0.694	0.83
83_C	94_M	0.692	0.83
23_K	196_R	0.692	0.83
8_S	22_P	0.691	0.83
15_M	22_P	0.690	0.83
169_R	172_H	0.681	0.82
34_G	114_M	0.677	0.81
59_V	126_E	0.675	0.81
142_A	170_I	0.673	0.81
26_V	191_A	0.671	0.81
14_F	20_I	0.670	0.81
155_Y	159_L	0.666	0.80
90_D	110_A	0.664	0.80
109_G	152_T	0.663	0.80
30_F	63_I	0.662	0.80
82_I	103_Q	0.661	0.80
78_D	101_N	0.660	0.80
150_E	190_K	0.654	0.79
99_E	192_L	0.652	0.79
109_G	122_I	0.652	0.79
73_E	133_D	0.650	0.79
13_S	43_F	0.650	0.79
77_R	95_E	0.647	0.79
70_Y	165_I	0.647	0.79
81_V	166_K	0.647	0.79
120_E	125_P	0.643	0.78
125_P	159_L	0.642	0.78
43_F	175_P	0.639	0.78
178_G	187_T	0.639	0.78
33_L	50_A	0.633	0.77
91_V	145_P	0.633	0.77
183_A	194_G	0.629	0.77
126_E	129_K	0.626	0.76
61_G	179_D	0.625	0.76
137_T	166_K	0.615	0.75
129_K	161_K	0.612	0.75
171_A	195_R	0.611	0.74
91_V	189_S	0.606	0.74
21_G	25_A	0.606	0.74
170_I	182_Y	0.605	0.74
117_I	121_D	0.604	0.74
12_D	42_D	0.592	0.72
177_G	195_R	0.591	0.72
175_P	184_D	0.591	0.72
26_V	181_E	0.590	0.72
96_K	105_H	0.589	0.72
105_H	155_Y	0.587	0.72
73_E	84_V	0.587	0.72
70_Y	101_N	0.586	0.71
23_K	179_D	0.581	0.71
99_E	193_E	0.579	0.70
113_P	118_G	0.579	0.70
164_G	167_L	0.578	0.70
21_G	27_R	0.578	0.70
82_I	105_H	0.575	0.70
81_V	101_N	0.574	0.70
87_D	93_A	0.574	0.70
136_V	139_V	0.573	0.70
17_L	21_G	0.572	0.70
90_D	93_A	0.570	0.69
42_D	45_K	0.567	0.69
99_E	190_K	0.566	0.69
5_E	8_S	0.566	0.69
91_V	94_M	0.565	0.69
83_C	192_L	0.565	0.69
144_N	172_H	0.565	0.69
46_A	49_N	0.565	0.69
59_V	62_H	0.565	0.69
5_E	70_Y	0.565	0.69
110_A	170_I	0.561	0.68
7_I	13_S	0.560	0.68
35_M	40_V	0.556	0.67
185_E	188_L	0.555	0.67
154_M	158_R	0.554	0.67
18_P	25_A	0.553	0.67
131_L	163_S	0.552	0.67
34_G	89_K	0.552	0.67
118_G	151_A	0.549	0.66
7_I	114_M	0.548	0.66
109_G	130_R	0.545	0.66
116_G	146_N	0.545	0.66
18_P	21_G	0.543	0.66
31_F	35_M	0.543	0.66
11_I	30_F	0.541	0.65
71_I	188_L	0.541	0.65
108_H	143_T	0.541	0.65
36_K	159_L	0.541	0.65
14_F	33_L	0.540	0.65
87_D	91_V	0.538	0.65
83_C	142_A	0.537	0.65
128_L	156_I	0.535	0.64
55_T	66_Q	0.534	0.64
23_K	178_G	0.533	0.64
176_V	196_R	0.528	0.63
160_L	186_V	0.527	0.63
10_L	191_A	0.527	0.63
92_I	172_H	0.522	0.63
145_P	188_L	0.521	0.62
10_L	14_F	0.518	0.62
168_S	171_A	0.518	0.62
30_F	108_H	0.517	0.62
12_D	15_M	0.517	0.62
100_Y	140_I	0.516	0.62
157_S	161_K	0.515	0.62
79_K	166_K	0.514	0.61
90_D	179_D	0.514	0.61
153_A	169_R	0.511	0.61
172_H	176_V	0.510	0.61
82_I	142_A	0.510	0.61
143_T	149_G	0.509	0.61
175_P	183_A	0.507	0.60
80_S	103_Q	0.506	0.60
75_T	103_Q	0.506	0.60
154_M	194_G	0.506	0.60
7_I	67_D	0.504	0.60
56_Y	61_G	0.502	0.60
49_N	52_R	0.501	0.59
13_S	94_M	0.501	0.59
120_E	193_E	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3vdpA	2	1	100	0.051	Contact Map
1vddA	7	0.9899	100	0.066	Contact Map
1mw9X	1	0.5455	97.2	0.899	Contact Map
2gaiA	1	0.5253	97.1	0.9	Contact Map
4dduA	1	0.8737	96.3	0.909	Contact Map
4cgyA	1	0.6162	96.2	0.91	Contact Map
1i7dA	1	0.697	95.9	0.913	Contact Map
1gkuB	1	0.8232	95.7	0.914	Contact Map
2fcjA	2	0.5404	94.2	0.921	Contact Map
2owoA	1	0.2727	87.3	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.