YLXF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLXF - FlaA locus 22.9 kDa protein

UniProt:	P23454	Sequences: MSGKKKESGKFRSVLLIIILPLMFLLIAGGIVLWAAGINVLKPIQDAAAKTPVLKELVPETENKKGAASSKDSSNTAALEKTIKDQKSEISILNKDLETSKSEIDRLNQKIRSLEKTAEDQKKSSEDHTEGSADSKASSENDKVISVYKSMDSGKAAKIIAQLKEQEALKILNGLSKKQLADILAKMTPEQAATYTEKIAASQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	204 (173)
Sequences:	578 (493)
Seq/√Len:	37.4

BACSU - YLXF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_I	93_L	3.435	1.00
83_I	86_Q	3.375	1.00
111_I	114_L	3.362	1.00
167_E	186_K	2.853	1.00
76_T	79_L	2.763	1.00
104_I	107_L	2.756	1.00
118_A	121_Q	2.579	1.00
171_I	196_T	2.525	1.00
27_I	31_I	2.440	1.00
51_T	54_L	2.364	1.00
85_D	89_E	2.274	0.99
163_L	168_A	2.166	0.99
144_V	175_L	2.067	0.99
168_A	172_L	2.053	0.99
140_E	143_K	1.960	0.98
110_K	113_S	1.910	0.98
21_P	24_F	1.896	0.98
172_L	180_L	1.872	0.98
148_Y	196_T	1.866	0.98
18_I	21_P	1.862	0.98
161_A	188_T	1.790	0.97
112_R	115_E	1.751	0.97
123_K	126_E	1.710	0.96
182_D	185_A	1.701	0.96
101_K	111_I	1.651	0.95
150_S	153_S	1.633	0.95
161_A	191_Q	1.614	0.95
22_L	25_L	1.612	0.95
148_Y	158_K	1.608	0.95
86_Q	90_I	1.563	0.94
32_V	36_A	1.526	0.93
158_K	161_A	1.526	0.93
22_L	29_G	1.514	0.93
148_Y	181_A	1.482	0.92
78_A	139_S	1.460	0.91
15_L	19_I	1.455	0.91
146_S	150_S	1.454	0.91
147_V	180_L	1.431	0.90
139_S	190_E	1.416	0.90
93_L	100_S	1.405	0.90
33_L	163_L	1.404	0.89
152_D	186_K	1.402	0.89
145_I	197_E	1.370	0.88
107_L	110_K	1.364	0.88
108_N	112_R	1.359	0.88
53_V	58_V	1.357	0.88
166_Q	198_K	1.353	0.88
53_V	57_L	1.342	0.87
101_K	104_I	1.341	0.87
188_T	191_Q	1.340	0.87
54_L	57_L	1.338	0.87
89_E	92_I	1.337	0.87
30_G	34_W	1.320	0.86
172_L	193_A	1.319	0.86
167_E	171_I	1.315	0.86
101_K	145_I	1.301	0.86
118_A	144_V	1.287	0.85
96_D	99_T	1.284	0.85
144_V	196_T	1.278	0.84
104_I	159_I	1.270	0.84
24_F	36_A	1.250	0.83
39_N	42_K	1.246	0.83
20_L	25_L	1.236	0.82
115_E	119_E	1.216	0.81
171_I	193_A	1.199	0.80
107_L	111_I	1.156	0.78
79_L	169_L	1.156	0.78
190_E	194_T	1.135	0.77
76_T	153_S	1.133	0.77
100_S	104_I	1.114	0.75
149_K	179_Q	1.112	0.75
153_S	185_A	1.108	0.75
168_A	195_Y	1.106	0.75
54_L	61_T	1.106	0.75
159_I	201_A	1.097	0.74
121_Q	125_S	1.096	0.74
191_Q	195_Y	1.095	0.74
187_M	195_Y	1.094	0.74
21_P	187_M	1.089	0.74
146_S	149_K	1.088	0.74
55_K	83_I	1.072	0.72
93_L	96_D	1.070	0.72
84_K	88_S	1.054	0.71
108_N	114_L	1.044	0.70
23_M	26_L	1.039	0.70
138_S	174_G	1.038	0.70
107_L	148_Y	1.012	0.68
82_T	85_D	1.006	0.67
160_I	187_M	1.005	0.67
79_L	152_D	0.992	0.66
31_I	37_G	0.992	0.66
197_E	200_A	0.985	0.66
80_E	187_M	0.982	0.66
114_L	117_T	0.971	0.65
165_E	198_K	0.970	0.65
28_A	97_L	0.969	0.65
149_K	181_A	0.968	0.64
109_Q	112_R	0.965	0.64
177_K	181_A	0.962	0.64
165_E	194_T	0.960	0.64
167_E	181_A	0.956	0.63
176_S	197_E	0.952	0.63
143_K	149_K	0.952	0.63
102_S	166_Q	0.952	0.63
165_E	168_A	0.945	0.63
86_Q	105_D	0.944	0.62
148_Y	155_K	0.942	0.62
164_K	183_I	0.942	0.62
27_I	30_G	0.942	0.62
82_T	86_Q	0.935	0.62
152_D	167_E	0.930	0.61
141_N	144_V	0.929	0.61
23_M	64_K	0.925	0.61
169_L	199_I	0.923	0.61
114_L	181_A	0.920	0.60
146_S	177_K	0.910	0.60
163_L	195_Y	0.902	0.59
100_S	108_N	0.902	0.59
195_Y	198_K	0.901	0.59
98_E	108_N	0.899	0.59
164_K	167_E	0.894	0.58
169_L	180_L	0.892	0.58
48_A	58_V	0.888	0.58
76_T	115_E	0.884	0.57
60_E	63_N	0.876	0.57
27_I	37_G	0.875	0.57
160_I	193_A	0.858	0.55
169_L	195_Y	0.841	0.54
170_K	195_Y	0.840	0.54
168_A	179_Q	0.833	0.53
146_S	179_Q	0.833	0.53
93_L	107_L	0.827	0.52
159_I	171_I	0.825	0.52
160_I	197_E	0.825	0.52
44_I	164_K	0.822	0.52
153_S	189_P	0.820	0.52
165_E	169_L	0.816	0.51
170_K	174_G	0.808	0.51
96_D	107_L	0.808	0.51
171_I	197_E	0.805	0.50
62_E	99_T	0.805	0.50
171_I	201_A	0.805	0.50
113_S	117_T	0.804	0.50
88_S	92_I	0.801	0.50
79_L	93_L	0.800	0.50
33_L	86_Q	0.800	0.50
165_E	180_L	0.796	0.50
111_I	140_E	0.796	0.50
66_G	89_E	0.795	0.50
98_E	102_S	0.795	0.50
21_P	180_L	0.789	0.49
19_I	101_K	0.777	0.48
177_K	180_L	0.772	0.47
168_A	197_E	0.767	0.47
26_L	171_I	0.765	0.47
147_V	181_A	0.758	0.46
96_D	168_A	0.756	0.46
48_A	53_V	0.755	0.46
31_I	91_S	0.753	0.46
98_E	123_K	0.752	0.46
150_S	178_K	0.745	0.45
144_V	189_P	0.737	0.44
24_F	191_Q	0.735	0.44
81_K	104_I	0.729	0.44
117_T	162_Q	0.727	0.44
144_V	167_E	0.727	0.44
148_Y	153_S	0.726	0.43
22_L	165_E	0.717	0.43
74_S	121_Q	0.715	0.42
167_E	193_A	0.710	0.42
179_Q	182_D	0.710	0.42
40_V	47_A	0.709	0.42
187_M	198_K	0.704	0.42
109_Q	113_S	0.699	0.41
178_K	185_A	0.693	0.41
153_S	182_D	0.689	0.40
62_E	66_G	0.686	0.40
111_I	148_Y	0.680	0.39
168_A	193_A	0.673	0.39
162_Q	193_A	0.670	0.39
118_A	164_K	0.670	0.39
25_L	29_G	0.667	0.38
20_L	183_I	0.663	0.38
116_K	120_D	0.662	0.38
143_K	146_S	0.648	0.37
22_L	62_E	0.646	0.37
46_D	49_A	0.645	0.37
125_S	128_H	0.645	0.37
159_I	173_N	0.632	0.35
32_V	89_E	0.631	0.35
104_I	148_Y	0.630	0.35
31_I	35_A	0.629	0.35
60_E	101_K	0.628	0.35
36_A	91_S	0.623	0.35
44_I	116_K	0.614	0.34
95_K	99_T	0.612	0.34
83_I	122_K	0.611	0.34
45_Q	63_N	0.608	0.34
59_P	175_L	0.607	0.33
128_H	139_S	0.606	0.33
124_S	159_I	0.605	0.33
140_E	146_S	0.602	0.33
63_N	123_K	0.595	0.33
76_T	163_L	0.594	0.32
144_V	171_I	0.593	0.32
105_D	108_N	0.593	0.32
49_A	58_V	0.591	0.32
117_T	121_Q	0.585	0.32
18_I	24_F	0.582	0.32
92_I	195_Y	0.581	0.31
86_Q	94_N	0.579	0.31
45_Q	106_R	0.578	0.31
148_Y	187_M	0.575	0.31
121_Q	128_H	0.575	0.31
81_K	99_T	0.574	0.31
79_L	180_L	0.573	0.31
106_R	141_N	0.571	0.31
145_I	158_K	0.571	0.31
143_K	177_K	0.569	0.31
165_E	197_E	0.568	0.30
137_A	181_A	0.561	0.30
100_S	103_E	0.560	0.30
28_A	154_G	0.557	0.30
145_I	163_L	0.556	0.30
113_S	183_I	0.553	0.29
28_A	31_I	0.552	0.29
93_L	157_A	0.550	0.29
81_K	166_Q	0.548	0.29
102_S	119_E	0.548	0.29
15_L	85_D	0.547	0.29
22_L	166_Q	0.547	0.29
49_A	56_E	0.543	0.29
153_S	164_K	0.538	0.28
76_T	101_K	0.538	0.28
123_K	154_G	0.535	0.28
180_L	196_T	0.534	0.28
158_K	189_P	0.534	0.28
50_K	55_K	0.530	0.28
51_T	113_S	0.529	0.28
100_S	143_K	0.524	0.27
108_N	111_I	0.524	0.27
147_V	179_Q	0.523	0.27
138_S	151_M	0.522	0.27
146_S	176_S	0.521	0.27
160_I	168_A	0.521	0.27
88_S	106_R	0.520	0.27
159_I	162_Q	0.520	0.27
27_I	124_S	0.518	0.27
112_R	148_Y	0.512	0.26
31_I	66_G	0.509	0.26
114_L	159_I	0.509	0.26
160_I	171_I	0.509	0.26
40_V	43_P	0.508	0.26
125_S	189_P	0.507	0.26
42_K	163_L	0.504	0.26
165_E	172_L	0.503	0.26
42_K	89_E	0.502	0.26
17_I	41_L	0.502	0.26
170_K	201_A	0.500	0.26
26_L	63_N	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fhrB	1	0.3284	96.4	0.847	Contact Map
3uswA	1	0.299	96	0.853	Contact Map
2ouxA	2	0.5147	95.8	0.854	Contact Map
4cgkA	3	0.6176	95.2	0.861	Contact Map
4q4gX	1	0	94.4	0.866	Contact Map
4fq0C	1	0.3039	88.2	0.887	Contact Map
2zy9A	2	0.4216	86.2	0.891	Contact Map
2yvyA	2	0.4265	85.2	0.892	Contact Map
3hjlA	1	0.799	78.7	0.899	Contact Map
3kxrA	3	0.2745	72.9	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.