FLIH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIH - Probable flagellar assembly protein FliH

UniProt:	P23449	Sequences: MARVKEEADRISEQANSHIENIRRQIEQEKNDWAAEKQKLIEEAKAEGFEQGVALGKAEAMKQYAELIGQANSITEMSRKAVEDKLEDANEEIVELAVALAKKVWQQKSDDKEAFLLLVQQVINEVKEYDDISIYVDPYYYETIFQQKDEIQQLLYKECRLGIYADEKAQKGTCYIETPFGRVDASVDTQLMQLKDKLLTALEAGAAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (174)
Sequences:	1671 (1369)
Seq/√Len:	103.8

ECOLI - FLIH
BACSU - FLIH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_L	44_A	3.992	1.00
36_E	40_L	3.388	1.00
42_E	46_A	3.377	1.00
55_L	59_E	2.922	1.00
169_A	173_T	2.858	1.00
59_E	63_Q	2.828	1.00
44_A	48_G	2.782	1.00
56_G	60_A	2.624	1.00
47_E	51_Q	2.615	1.00
97_A	101_A	2.596	1.00
51_Q	55_L	2.542	1.00
46_A	50_E	2.541	1.00
42_E	45_K	2.463	1.00
41_I	45_K	2.397	1.00
43_E	47_E	2.277	1.00
36_E	44_A	2.219	1.00
32_D	36_E	2.204	1.00
34_A	37_K	2.111	1.00
53_V	57_K	2.053	1.00
39_K	43_E	2.045	1.00
33_W	37_K	2.008	1.00
38_Q	42_E	1.968	1.00
50_E	54_A	1.906	1.00
100_L	194_L	1.813	1.00
106_Q	121_Q	1.746	1.00
49_F	53_V	1.738	1.00
58_A	62_K	1.737	1.00
28_Q	32_D	1.722	1.00
140_Y	172_G	1.717	1.00
29_E	33_W	1.688	1.00
37_K	41_I	1.653	1.00
135_Y	175_Y	1.646	1.00
54_A	58_A	1.611	1.00
184_D	189_T	1.608	1.00
71_A	78_S	1.544	1.00
45_K	49_F	1.543	1.00
141_Y	145_F	1.537	1.00
54_A	57_K	1.519	1.00
30_K	33_W	1.474	1.00
61_M	65_A	1.472	1.00
57_K	61_M	1.472	1.00
136_V	163_I	1.455	1.00
139_Y	171_K	1.449	1.00
41_I	47_E	1.412	1.00
38_Q	41_I	1.409	1.00
27_E	31_N	1.407	1.00
49_F	59_E	1.397	1.00
34_A	38_Q	1.393	1.00
103_K	106_Q	1.386	1.00
170_Q	188_D	1.351	0.99
64_Y	67_L	1.347	0.99
35_A	39_K	1.344	0.99
55_L	58_A	1.341	0.99
141_Y	165_A	1.318	0.99
84_D	88_D	1.315	0.99
137_D	169_A	1.285	0.99
177_E	182_R	1.282	0.99
173_T	186_S	1.260	0.99
26_I	29_E	1.259	0.99
173_T	184_D	1.257	0.99
102_K	108_K	1.247	0.99
45_K	51_Q	1.189	0.99
52_G	56_G	1.186	0.99
50_E	53_V	1.182	0.99
25_Q	29_E	1.172	0.98
41_I	51_Q	1.146	0.98
30_K	36_E	1.146	0.98
137_D	171_K	1.144	0.98
108_K	111_D	1.126	0.98
30_K	34_A	1.122	0.98
37_K	40_L	1.114	0.98
138_P	165_A	1.112	0.98
36_E	39_K	1.100	0.98
46_A	49_F	1.094	0.98
65_A	69_G	1.091	0.98
45_K	55_L	1.084	0.97
90_N	120_Q	1.082	0.97
33_W	40_L	1.069	0.97
101_A	105_W	1.066	0.97
141_Y	163_I	1.063	0.97
170_Q	173_T	1.062	0.97
140_Y	171_K	1.060	0.97
60_A	64_Y	1.059	0.97
104_V	194_L	1.046	0.97
37_K	44_A	1.044	0.97
43_E	46_A	1.040	0.97
126_V	181_G	1.030	0.97
30_K	40_L	1.024	0.96
26_I	30_K	1.001	0.96
135_Y	166_D	1.000	0.96
31_N	35_A	0.987	0.96
57_K	60_A	0.986	0.96
169_A	186_S	0.984	0.96
25_Q	28_Q	0.962	0.95
49_F	55_L	0.958	0.95
67_L	70_Q	0.953	0.95
26_I	33_W	0.951	0.95
142_E	146_Q	0.947	0.94
107_Q	114_A	0.939	0.94
107_Q	111_D	0.932	0.94
102_K	195_K	0.932	0.94
48_G	52_G	0.930	0.94
103_K	190_Q	0.923	0.94
72_N	76_E	0.913	0.93
105_W	108_K	0.905	0.93
130_D	179_P	0.897	0.93
63_Q	66_E	0.895	0.93
40_L	48_G	0.890	0.92
121_Q	190_Q	0.884	0.92
53_V	56_G	0.880	0.92
134_I	176_I	0.878	0.92
67_L	71_A	0.873	0.92
67_L	75_T	0.872	0.92
137_D	140_Y	0.868	0.91
193_Q	196_D	0.866	0.91
53_V	63_Q	0.863	0.91
41_I	44_A	0.857	0.91
58_A	61_M	0.838	0.90
81_A	84_D	0.832	0.90
137_D	173_T	0.825	0.89
142_E	145_F	0.824	0.89
57_K	63_Q	0.821	0.89
136_V	141_Y	0.820	0.89
116_L	120_Q	0.813	0.89
33_W	36_E	0.811	0.88
76_E	80_K	0.802	0.88
193_Q	197_K	0.777	0.86
135_Y	164_Y	0.769	0.86
90_N	191_L	0.768	0.86
144_I	163_I	0.763	0.85
135_Y	177_E	0.760	0.85
35_A	38_Q	0.759	0.85
133_S	174_C	0.753	0.84
107_Q	117_L	0.750	0.84
137_D	141_Y	0.749	0.84
86_L	89_A	0.743	0.84
62_K	65_A	0.741	0.84
99_A	102_K	0.737	0.83
123_I	181_G	0.732	0.83
82_V	86_L	0.729	0.83
40_L	43_E	0.724	0.82
119_V	174_C	0.719	0.82
69_G	73_S	0.719	0.82
41_I	48_G	0.717	0.81
148_K	163_I	0.713	0.81
108_K	114_A	0.710	0.81
28_Q	31_N	0.710	0.81
59_E	62_K	0.710	0.81
132_I	176_I	0.708	0.81
124_N	134_I	0.708	0.81
111_D	114_A	0.694	0.79
187_V	194_L	0.694	0.79
81_A	181_G	0.692	0.79
51_Q	54_A	0.689	0.79
161_L	190_Q	0.685	0.78
53_V	59_E	0.679	0.78
143_T	146_Q	0.675	0.77
175_Y	182_R	0.672	0.77
32_D	40_L	0.670	0.77
197_K	200_T	0.670	0.77
77_M	84_D	0.669	0.77
65_A	68_I	0.662	0.76
138_P	173_T	0.660	0.76
30_K	37_K	0.660	0.76
100_L	104_V	0.659	0.76
102_K	188_D	0.654	0.75
29_E	36_E	0.648	0.75
28_Q	36_E	0.644	0.74
122_V	183_V	0.644	0.74
73_S	76_E	0.643	0.74
135_Y	182_R	0.642	0.74
46_A	69_G	0.639	0.74
181_G	185_A	0.639	0.74
80_K	84_D	0.637	0.73
37_K	47_E	0.636	0.73
188_D	192_M	0.634	0.73
36_E	41_I	0.634	0.73
78_S	89_A	0.633	0.73
195_K	198_L	0.633	0.73
27_E	34_A	0.630	0.72
31_N	34_A	0.629	0.72
133_S	177_E	0.625	0.72
185_A	189_T	0.624	0.72
78_S	86_L	0.624	0.72
122_V	126_V	0.623	0.72
104_V	190_Q	0.620	0.71
26_I	32_D	0.619	0.71
94_V	179_P	0.619	0.71
71_A	74_I	0.615	0.71
115_F	118_L	0.613	0.70
134_I	163_I	0.609	0.70
147_Q	164_Y	0.606	0.70
56_G	74_I	0.599	0.69
115_F	174_C	0.598	0.69
43_E	77_M	0.597	0.68
175_Y	186_S	0.593	0.68
174_C	189_T	0.592	0.68
27_E	30_K	0.592	0.68
63_Q	67_L	0.591	0.68
80_K	83_E	0.589	0.67
96_L	100_L	0.586	0.67
184_D	190_Q	0.586	0.67
45_K	53_V	0.585	0.67
86_L	127_K	0.584	0.67
166_D	198_L	0.579	0.66
131_D	162_G	0.579	0.66
66_E	70_Q	0.578	0.66
117_L	121_Q	0.576	0.66
174_C	185_A	0.574	0.65
31_N	61_M	0.573	0.65
77_M	80_K	0.572	0.65
103_K	107_Q	0.572	0.65
189_T	193_Q	0.571	0.65
181_G	195_K	0.568	0.65
55_L	62_K	0.566	0.64
166_D	175_Y	0.565	0.64
69_G	76_E	0.563	0.64
33_W	44_A	0.559	0.63
97_A	191_L	0.555	0.63
174_C	190_Q	0.554	0.63
102_K	105_W	0.554	0.63
78_S	181_G	0.551	0.62
97_A	158_E	0.549	0.62
143_T	171_K	0.545	0.61
61_M	68_I	0.540	0.61
133_S	162_G	0.539	0.61
35_A	58_A	0.537	0.60
101_A	104_V	0.537	0.60
46_A	58_A	0.536	0.60
39_K	44_A	0.531	0.59
152_Q	160_R	0.531	0.59
173_T	188_D	0.528	0.59
90_N	94_V	0.527	0.59
133_S	164_Y	0.527	0.59
115_F	171_K	0.525	0.59
129_Y	179_P	0.524	0.58
89_A	136_V	0.522	0.58
177_E	183_V	0.521	0.58
186_S	189_T	0.521	0.58
182_R	191_L	0.520	0.58
176_I	194_L	0.518	0.58
105_W	114_A	0.517	0.57
34_A	41_I	0.516	0.57
173_T	189_T	0.516	0.57
185_A	198_L	0.516	0.57
62_K	66_E	0.513	0.57
111_D	117_L	0.512	0.57
50_E	58_A	0.511	0.57
186_S	190_Q	0.511	0.57
89_A	120_Q	0.510	0.56
92_E	177_E	0.510	0.56
173_T	185_A	0.508	0.56
54_A	109_S	0.507	0.56
47_E	50_E	0.507	0.56
25_Q	30_K	0.506	0.56
103_K	151_I	0.506	0.56
100_L	122_V	0.505	0.56
128_E	181_G	0.504	0.56
68_I	72_N	0.503	0.55
128_E	179_P	0.501	0.55
49_F	52_G	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dm9A	2	0.5481	99.8	0.514	Contact Map
3v6iA	1	0.8654	99.7	0.591	Contact Map
4efaE	1	0.9375	99.6	0.621	Contact Map
3lg8A	1	0.4808	97.9	0.798	Contact Map
2wssS	1	0.6827	92.2	0.872	Contact Map
2lc0A	1	0.5192	90.4	0.878	Contact Map
4efaG	1	0.4327	50.3	0.914	Contact Map
1l2pA	1	0.2933	29.6	0.924	Contact Map
3v6iB	1	0.4375	28.2	0.925	Contact Map
2kk7A	1	0.2115	23.8	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.