RS20 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS20 - 30S ribosomal protein S20

UniProt:	P21477	Sequences: MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDKAVKTGLVHKNTAARYKSRLAKKVNGLSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	88 (86)
Sequences:	2204 (1137)
Seq/√Len:	122.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_V	83_V	3.253	1.00
43_E	46_K	3.093	1.00
2_P	11_T	2.697	1.00
59_D	76_K	2.692	1.00
14_N	18_R	2.656	1.00
33_K	37_A	2.330	1.00
8_I	12_K	2.005	1.00
71_T	75_Y	1.960	1.00
27_A	57_R	1.904	1.00
28_M	67_V	1.868	1.00
44_A	48_K	1.839	1.00
36_E	82_K	1.793	1.00
62_V	72_A	1.699	1.00
26_S	30_T	1.686	1.00
51_L	55_A	1.680	1.00
18_R	22_A	1.611	1.00
15_N	18_R	1.549	1.00
46_K	50_A	1.503	1.00
67_V	71_T	1.457	1.00
45_D	49_T	1.455	1.00
56_K	60_K	1.415	1.00
24_I	66_L	1.403	1.00
45_D	48_K	1.395	1.00
58_I	72_A	1.394	1.00
48_K	52_T	1.363	1.00
51_L	83_V	1.323	1.00
35_V	39_V	1.269	1.00
15_N	19_V	1.242	0.99
20_H	24_I	1.237	0.99
53_E	57_R	1.236	0.99
35_V	51_L	1.220	0.99
74_R	78_R	1.207	0.99
49_T	52_T	1.201	0.99
27_A	31_A	1.198	0.99
46_K	49_T	1.197	0.99
36_E	40_A	1.178	0.99
51_L	80_A	1.172	0.99
82_K	85_G	1.168	0.99
55_A	80_A	1.160	0.99
81_K	85_G	1.134	0.99
39_V	82_K	1.128	0.99
4_I	8_I	1.111	0.99
62_V	67_V	1.105	0.99
13_T	17_R	1.100	0.99
10_R	14_N	1.085	0.99
10_R	13_T	1.045	0.98
38_S	50_A	1.001	0.98
16_E	20_H	0.998	0.98
30_T	34_Q	0.996	0.97
49_T	53_E	0.960	0.97
60_K	63_K	0.941	0.96
80_A	84_N	0.930	0.96
28_M	61_A	0.923	0.96
11_T	15_N	0.902	0.95
35_V	54_A	0.894	0.95
31_A	57_R	0.886	0.95
32_I	58_I	0.886	0.95
11_T	14_N	0.884	0.95
56_K	63_K	0.871	0.95
40_A	82_K	0.867	0.94
19_V	23_T	0.849	0.94
81_K	84_N	0.839	0.93
70_N	76_K	0.822	0.93
35_V	79_L	0.821	0.93
50_A	54_A	0.821	0.93
19_V	22_A	0.806	0.92
67_V	72_A	0.771	0.90
44_A	86_L	0.770	0.90
52_T	55_A	0.763	0.90
73_A	77_S	0.763	0.90
24_I	61_A	0.762	0.90
52_T	56_K	0.758	0.89
39_V	83_V	0.754	0.89
23_T	27_A	0.746	0.89
8_I	11_T	0.738	0.88
7_A	14_N	0.733	0.88
34_Q	46_K	0.717	0.87
38_S	46_K	0.700	0.85
34_Q	50_A	0.683	0.84
7_A	71_T	0.667	0.82
21_N	24_I	0.658	0.82
31_A	54_A	0.652	0.81
4_I	7_A	0.645	0.80
26_S	29_R	0.641	0.80
12_K	16_E	0.640	0.80
34_Q	53_E	0.639	0.80
36_E	78_R	0.637	0.79
62_V	76_K	0.631	0.79
6_S	61_A	0.626	0.78
36_E	75_Y	0.623	0.78
27_A	30_T	0.623	0.78
58_I	79_L	0.623	0.78
34_Q	37_A	0.617	0.77
35_V	50_A	0.617	0.77
29_R	75_Y	0.609	0.76
13_T	16_E	0.605	0.76
14_N	17_R	0.605	0.76
32_I	36_E	0.601	0.75
4_I	11_T	0.601	0.75
43_E	47_A	0.600	0.75
74_R	79_L	0.594	0.75
75_Y	79_L	0.592	0.74
4_I	12_K	0.592	0.74
38_S	47_A	0.584	0.73
47_A	83_V	0.584	0.73
37_A	41_N	0.578	0.73
57_R	61_A	0.576	0.72
55_A	59_D	0.575	0.72
7_A	13_T	0.564	0.71
53_E	56_K	0.561	0.70
52_T	77_S	0.560	0.70
5_K	12_K	0.558	0.70
26_S	31_A	0.552	0.69
39_V	44_A	0.548	0.69
47_A	51_L	0.546	0.68
73_A	76_K	0.546	0.68
23_T	26_S	0.539	0.67
38_S	43_E	0.538	0.67
55_A	76_K	0.538	0.67
5_K	84_N	0.534	0.67
28_M	66_L	0.531	0.66
7_A	10_R	0.525	0.65
14_N	74_R	0.515	0.64
5_K	8_I	0.515	0.64
31_A	50_A	0.509	0.63
4_I	13_T	0.506	0.62
31_A	53_E	0.505	0.62
24_I	64_T	0.505	0.62
59_D	62_V	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rb5T	1	0.9773	100	0.055	Contact Map
3bbnT	1	1	100	0.06	Contact Map
4tp8T	1	0.9659	100	0.11	Contact Map
3osrA	1	0.4659	15.6	0.909	Contact Map
4bujB	1	0.7386	6.6	0.923	Contact Map
4qinA	2	0.9091	6.5	0.924	Contact Map
4lcbA	1	0	5	0.928	Contact Map
2ra1A	1	0.8523	4.6	0.929	Contact Map
3lofA	2	0.875	3.8	0.932	Contact Map
1vykA	1	0.6932	3.2	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0134 seconds.