RS10 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS10 - 30S ribosomal protein S10

UniProt:	P21471	Sequences: MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (99)
Sequences:	799 (353)
Seq/√Len:	35.5

ECOLI - RS10
BACSU - RS10
HALSA - RS10
SULSO - RS10

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_T	64_Q	5.184	1.00
53_R	61_S	4.610	1.00
7_R	75_D	4.313	1.00
32_S	83_T	4.302	1.00
47_S	69_T	3.764	1.00
50_T	62_R	3.189	1.00
54_A	58_Y	2.974	1.00
52_L	55_V	2.439	1.00
12_A	18_L	2.242	0.99
54_A	57_K	2.072	0.99
46_K	68_R	1.844	0.97
18_L	22_A	1.707	0.96
12_A	91_D	1.634	0.94
75_D	90_L	1.582	0.93
52_L	60_D	1.568	0.93
57_K	60_D	1.547	0.92
52_L	56_H	1.539	0.92
53_R	65_F	1.530	0.92
61_S	65_F	1.470	0.90
23_E	27_E	1.452	0.90
28_T	31_R	1.413	0.88
5_K	18_L	1.407	0.88
55_V	58_Y	1.379	0.87
93_P	98_I	1.372	0.87
11_K	99_E	1.352	0.86
27_E	60_D	1.331	0.85
35_S	78_N	1.312	0.84
5_K	37_S	1.229	0.80
56_H	62_R	1.217	0.80
48_V	64_Q	1.160	0.76
47_S	67_M	1.153	0.76
22_A	37_S	1.140	0.75
28_T	86_A	1.120	0.74
15_H	19_D	1.107	0.73
24_K	91_D	1.076	0.71
52_L	57_K	1.069	0.70
47_S	50_T	1.016	0.66
19_D	72_R	1.007	0.65
16_R	19_D	0.986	0.64
47_S	64_Q	0.984	0.64
74_I	85_D	0.981	0.63
10_L	18_L	0.978	0.63
8_I	30_K	0.973	0.63
19_D	41_P	0.954	0.61
22_A	26_V	0.932	0.59
45_E	71_K	0.929	0.59
52_L	62_R	0.923	0.59
63_E	81_P	0.905	0.57
29_A	73_L	0.896	0.56
5_K	52_L	0.890	0.56
52_L	69_T	0.868	0.54
56_H	68_R	0.852	0.52
50_T	56_H	0.851	0.52
71_K	74_I	0.843	0.52
14_D	19_D	0.837	0.51
26_V	74_I	0.834	0.51
29_A	34_A	0.831	0.51
33_G	83_T	0.827	0.50
37_S	74_I	0.824	0.50
28_T	88_M	0.819	0.50
37_S	93_P	0.817	0.49
40_I	77_V	0.812	0.49
6_I	9_R	0.808	0.49
17_I	35_S	0.802	0.48
29_A	76_I	0.793	0.47
40_I	73_L	0.786	0.47
24_K	89_R	0.779	0.46
60_D	64_Q	0.766	0.45
48_V	51_I	0.760	0.45
66_E	78_N	0.757	0.44
88_M	97_D	0.753	0.44
18_L	21_S	0.753	0.44
37_S	77_V	0.750	0.44
17_I	21_S	0.748	0.44
47_S	71_K	0.742	0.43
14_D	41_P	0.739	0.43
53_R	63_E	0.735	0.42
6_I	36_V	0.734	0.42
3_K	58_Y	0.733	0.42
27_E	31_R	0.733	0.42
12_A	67_M	0.702	0.40
49_Y	69_T	0.692	0.39
30_K	56_H	0.688	0.39
37_S	67_M	0.685	0.38
28_T	90_L	0.683	0.38
27_E	79_P	0.670	0.37
54_A	91_D	0.669	0.37
9_R	45_E	0.666	0.37
35_S	77_V	0.665	0.37
42_L	73_L	0.665	0.37
80_T	85_D	0.662	0.36
25_I	74_I	0.661	0.36
45_E	58_Y	0.660	0.36
55_V	88_M	0.659	0.36
69_T	94_S	0.659	0.36
41_P	72_R	0.657	0.36
14_D	40_I	0.655	0.36
42_L	93_P	0.652	0.36
13_Y	100_I	0.643	0.35
17_I	101_K	0.640	0.35
49_Y	58_Y	0.639	0.35
24_K	94_S	0.636	0.34
82_Q	86_A	0.629	0.34
98_I	101_K	0.622	0.33
34_A	83_T	0.619	0.33
29_A	74_I	0.616	0.33
51_I	55_V	0.607	0.32
47_S	51_I	0.607	0.32
53_R	101_K	0.601	0.32
40_I	89_R	0.601	0.32
32_S	80_T	0.592	0.31
53_R	56_H	0.592	0.31
48_V	68_R	0.590	0.31
44_T	93_P	0.583	0.30
5_K	75_D	0.582	0.30
6_I	54_A	0.580	0.30
41_P	85_D	0.579	0.30
30_K	35_S	0.577	0.30
27_E	34_A	0.575	0.30
3_K	9_R	0.565	0.29
8_I	68_R	0.560	0.29
13_Y	45_E	0.560	0.29
42_L	99_E	0.559	0.29
73_L	92_L	0.559	0.29
88_M	98_I	0.559	0.29
24_K	82_Q	0.549	0.28
78_N	100_I	0.548	0.28
8_I	83_T	0.548	0.28
24_K	60_D	0.546	0.28
44_T	70_H	0.544	0.28
21_S	87_L	0.542	0.27
74_I	97_D	0.537	0.27
32_S	87_L	0.533	0.27
12_A	41_P	0.533	0.27
22_A	73_L	0.529	0.27
25_I	83_T	0.526	0.26
45_E	48_V	0.524	0.26
20_Q	30_K	0.517	0.26
21_S	73_L	0.515	0.26
15_H	63_E	0.511	0.25
25_I	28_T	0.510	0.25
31_R	49_Y	0.509	0.25
29_A	36_V	0.507	0.25
81_P	99_E	0.505	0.25
9_R	42_L	0.503	0.25
17_I	77_V	0.503	0.25
18_L	82_Q	0.502	0.25
25_I	41_P	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bbnJ	1	0.9706	100	0.23	Contact Map
3w1yC	1	0.8725	100	0.242	Contact Map
3zeyQ	1	0.9902	100	0.266	Contact Map
4rb5J	1	0.951	100	0.268	Contact Map
3j20L	1	0.9706	100	0.269	Contact Map
4w23U	1	0.9804	100	0.272	Contact Map
3j7aN	1	0.9216	100	0.273	Contact Map
4bpeJ	1	0.9902	100	0.276	Contact Map
3j60U	1	0.9902	100	0.276	Contact Map
4ujpV	1	0.9902	100	0.278	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.