RS7 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS7 - 30S ribosomal protein S7

UniProt:	P21469	Sequences: MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (151)
Sequences:	2354 (1100)
Seq/√Len:	89.5

ECOLI - RS7
BACSU - RS7
HALSA - RS7
SULSO - RS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_S	63_E	4.211	1.00
30_M	43_L	3.263	1.00
70_M	96_R	2.834	1.00
43_L	47_F	2.764	1.00
56_N	64_Q	2.637	1.00
106_N	110_L	2.551	1.00
74_E	95_R	2.477	1.00
45_K	117_E	2.414	1.00
136_K	140_D	2.300	1.00
69_I	104_L	2.299	1.00
28_N	36_K	2.268	1.00
26_L	101_L	2.224	1.00
49_I	118_E	2.206	1.00
67_K	70_M	2.116	1.00
9_K	94_E	2.099	1.00
107_Y	134_A	2.042	1.00
54_T	125_L	2.023	1.00
51_K	57_D	1.975	1.00
51_K	58_A	1.951	1.00
47_F	62_F	1.949	1.00
126_D	131_T	1.932	1.00
69_I	134_A	1.929	1.00
42_I	116_M	1.921	1.00
22_L	97_T	1.910	1.00
50_I	61_V	1.899	1.00
26_L	43_L	1.889	1.00
49_I	121_A	1.879	1.00
130_N	135_V	1.829	1.00
72_V	96_R	1.746	1.00
26_L	62_F	1.734	1.00
48_D	51_K	1.709	1.00
57_D	60_E	1.683	1.00
61_V	128_A	1.621	1.00
50_I	125_L	1.589	1.00
23_V	43_L	1.586	1.00
70_M	100_G	1.581	1.00
49_I	117_E	1.566	1.00
23_V	47_F	1.507	1.00
113_E	119_R	1.495	1.00
26_L	105_V	1.476	1.00
125_L	128_A	1.465	0.99
63_E	67_K	1.460	0.99
5_G	8_A	1.403	0.99
29_K	101_L	1.402	0.99
11_D	21_K	1.319	0.99
70_M	97_T	1.305	0.99
38_K	41_T	1.291	0.99
113_E	122_N	1.268	0.99
137_K	141_T	1.252	0.98
66_L	100_G	1.252	0.98
28_N	31_M	1.249	0.98
50_I	124_I	1.248	0.98
107_Y	133_A	1.240	0.98
56_N	60_E	1.205	0.98
25_R	97_T	1.191	0.98
101_L	105_V	1.172	0.98
115_T	118_E	1.170	0.97
47_F	58_A	1.163	0.97
77_A	84_N	1.152	0.97
66_L	135_V	1.146	0.97
98_T	102_R	1.129	0.97
32_I	109_R	1.101	0.96
50_I	54_T	1.093	0.96
95_R	99_L	1.090	0.96
135_V	138_R	1.059	0.95
25_R	31_M	1.058	0.95
47_F	50_I	1.055	0.95
26_L	124_I	1.053	0.95
30_M	39_S	1.050	0.95
29_K	97_T	1.050	0.95
66_L	101_L	1.032	0.95
69_I	124_I	1.030	0.95
17_I	48_D	1.014	0.94
46_S	120_L	1.004	0.94
75_V	86_Q	0.999	0.94
117_E	121_A	0.994	0.94
64_Q	128_A	0.984	0.93
27_I	40_Q	0.983	0.93
122_N	126_D	0.980	0.93
76_K	89_V	0.966	0.93
68_N	127_A	0.961	0.92
99_L	102_R	0.953	0.92
37_G	40_Q	0.950	0.92
22_L	66_L	0.945	0.92
85_Y	151_F	0.936	0.91
86_Q	148_N	0.926	0.91
99_L	103_W	0.924	0.91
107_Y	110_L	0.921	0.91
114_K	119_R	0.914	0.90
26_L	66_L	0.911	0.90
113_E	131_T	0.909	0.90
29_K	105_V	0.908	0.90
15_D	44_Y	0.908	0.90
112_G	149_K	0.896	0.90
111_R	122_N	0.895	0.90
12_V	24_S	0.879	0.89
68_N	128_A	0.878	0.89
68_N	130_N	0.867	0.88
41_T	45_K	0.859	0.88
54_T	128_A	0.857	0.87
60_E	64_Q	0.843	0.87
23_V	62_F	0.831	0.86
146_E	149_K	0.826	0.85
81_G	85_Y	0.815	0.85
22_L	101_L	0.814	0.85
85_Y	99_L	0.798	0.83
76_K	87_V	0.785	0.82
69_I	135_V	0.783	0.82
104_L	124_I	0.780	0.82
32_I	105_V	0.779	0.82
64_Q	67_K	0.767	0.81
49_I	53_R	0.766	0.81
56_N	61_V	0.764	0.81
80_V	90_E	0.752	0.80
74_E	99_L	0.749	0.79
45_K	48_D	0.739	0.78
6_P	9_K	0.738	0.78
72_V	130_N	0.736	0.78
79_R	86_Q	0.733	0.78
136_K	139_E	0.729	0.77
139_E	143_K	0.728	0.77
77_A	86_Q	0.719	0.76
23_V	59_M	0.717	0.76
24_S	40_Q	0.716	0.76
50_I	121_A	0.716	0.76
29_K	38_K	0.715	0.76
15_D	18_Y	0.708	0.75
76_K	91_V	0.708	0.75
53_R	125_L	0.698	0.74
83_A	91_V	0.696	0.74
77_A	89_V	0.694	0.74
79_R	145_A	0.692	0.74
29_K	98_T	0.690	0.73
30_M	42_I	0.685	0.73
115_T	122_N	0.685	0.73
78_R	85_Y	0.685	0.73
45_K	118_E	0.682	0.73
6_P	61_V	0.674	0.72
7_V	10_R	0.671	0.71
89_V	154_Y	0.665	0.71
82_G	151_F	0.664	0.71
65_A	68_N	0.657	0.70
131_T	154_Y	0.651	0.69
22_L	32_I	0.650	0.69
109_R	116_M	0.649	0.69
93_P	96_R	0.649	0.69
16_P	40_Q	0.646	0.69
48_D	52_E	0.646	0.69
25_R	29_K	0.646	0.69
18_Y	44_Y	0.642	0.68
67_K	87_V	0.637	0.67
6_P	125_L	0.637	0.67
81_G	150_A	0.635	0.67
5_G	101_L	0.629	0.66
53_R	122_N	0.627	0.66
5_G	77_A	0.626	0.66
46_S	50_I	0.622	0.66
103_W	141_T	0.622	0.66
138_R	142_H	0.619	0.65
17_I	51_K	0.619	0.65
127_A	135_V	0.615	0.65
73_L	77_A	0.614	0.65
83_A	89_V	0.612	0.64
127_A	132_G	0.611	0.64
104_L	127_A	0.608	0.64
91_V	99_L	0.603	0.63
141_T	144_M	0.603	0.63
113_E	116_M	0.601	0.63
22_L	96_R	0.598	0.63
118_E	122_N	0.598	0.63
127_A	134_A	0.597	0.62
27_I	44_Y	0.596	0.62
8_A	12_V	0.596	0.62
47_F	128_A	0.592	0.62
20_S	47_F	0.592	0.62
78_R	86_Q	0.592	0.62
29_K	66_L	0.591	0.62
67_K	96_R	0.589	0.61
49_I	52_E	0.588	0.61
68_N	95_R	0.585	0.61
54_T	61_V	0.581	0.60
94_E	98_T	0.570	0.59
14_P	18_Y	0.564	0.58
11_D	41_T	0.563	0.58
21_K	24_S	0.562	0.58
6_P	96_R	0.555	0.57
6_P	29_K	0.555	0.57
79_R	87_V	0.553	0.57
8_A	96_R	0.553	0.57
108_A	124_I	0.553	0.57
91_V	142_H	0.548	0.56
111_R	115_T	0.546	0.56
124_I	128_A	0.546	0.56
108_A	111_R	0.545	0.56
30_M	97_T	0.544	0.55
34_G	123_E	0.543	0.55
44_Y	78_R	0.541	0.55
73_L	116_M	0.541	0.55
79_R	144_M	0.538	0.55
70_M	93_P	0.538	0.55
30_M	105_V	0.534	0.54
5_G	89_V	0.532	0.54
73_L	145_A	0.528	0.53
10_R	94_E	0.528	0.53
86_Q	144_M	0.526	0.53
50_I	65_A	0.526	0.53
88_P	103_W	0.525	0.53
50_I	128_A	0.520	0.52
116_M	119_R	0.520	0.52
111_R	126_D	0.515	0.51
17_I	55_G	0.515	0.51
12_V	25_R	0.515	0.51
100_G	122_N	0.513	0.51
79_R	148_N	0.512	0.51
51_K	55_G	0.511	0.51
71_P	103_W	0.511	0.51
140_D	143_K	0.509	0.51
140_D	144_M	0.507	0.50
9_K	25_R	0.507	0.50
74_E	151_F	0.507	0.50
26_L	31_M	0.506	0.50
110_L	133_A	0.503	0.50
60_E	63_E	0.501	0.50
80_V	84_N	0.500	0.49
103_W	137_K	0.500	0.49
131_T	137_K	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kiyG	1	0.9679	100	0.007	Contact Map
1husA	1	0.891	100	0.028	Contact Map
1rssA	1	0.8974	100	0.053	Contact Map
3bbnG	1	0.9872	100	0.057	Contact Map
3gtyS	1	0.9551	100	0.057	Contact Map
5aj3G	1	0.9936	100	0.071	Contact Map
4tp8G	1	0.9679	100	0.095	Contact Map
3zey2	1	0.9551	100	0.199	Contact Map
4bpeG	1	0.9551	100	0.2	Contact Map
4ujpG	1	0.9295	100	0.203	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.