PAIB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PAIB - Protease synthase and sporulation protein PAI 2

UniProt:	P21341	Sequences: MYIPKYFKVTNAEEIWNFVQENSFGTVVTTEQGKPIATHLPLGFNKKDDHYYITGHFAYGNPQWRTFEACEDVLVMFQGPHAYISSSWYSRENVPTWNYQAVHMYGKASMLEKDELAEELTIMLEKYEKHRDNPVLWDKLSPKLLESELKGIVGFKIKVEDIQAAYKLSQNRNETDYMNVIEQLQNEENPNAKQMAELMEDKLKKQI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	207 (200)
Sequences:	1684 (1282)
Seq/√Len:	90.6

BACSU - PAIB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_M	162_I	3.616	1.00
185_Q	200_E	3.374	1.00
105_Y	161_D	3.357	1.00
109_S	156_K	3.264	1.00
172_R	176_D	3.103	1.00
25_G	42_L	2.989	1.00
37_A	74_L	2.950	1.00
42_L	55_G	2.942	1.00
15_I	164_A	2.840	1.00
73_V	157_I	2.700	1.00
39_H	103_H	2.514	1.00
38_T	63_Q	2.411	1.00
17_N	21_E	2.360	1.00
20_Q	46_K	2.213	1.00
116_L	154_G	2.205	1.00
29_T	63_Q	2.137	1.00
26_T	76_M	2.114	1.00
7_F	171_N	2.067	1.00
28_V	76_M	1.999	1.00
109_S	158_K	1.955	1.00
84_I	184_L	1.939	1.00
19_V	104_M	1.937	1.00
179_N	183_Q	1.914	1.00
98_N	199_M	1.868	1.00
120_L	152_I	1.844	1.00
26_T	78_Q	1.835	1.00
67_F	108_A	1.807	1.00
178_M	182_E	1.787	1.00
72_D	160_E	1.758	1.00
100_Q	166_Y	1.744	1.00
9_V	14_E	1.717	1.00
18_F	102_V	1.687	1.00
18_F	100_Q	1.629	1.00
31_E	34_K	1.605	1.00
53_I	75_V	1.600	1.00
82_A	195_M	1.556	1.00
75_V	157_I	1.552	1.00
9_V	166_Y	1.527	1.00
76_M	103_H	1.523	1.00
19_V	44_F	1.520	1.00
42_L	75_V	1.512	1.00
131_R	187_E	1.510	1.00
60_G	151_G	1.498	1.00
39_H	101_A	1.491	1.00
118_E	122_I	1.490	1.00
195_M	199_M	1.480	1.00
16_W	44_F	1.467	1.00
187_E	192_A	1.455	0.99
121_T	138_D	1.448	0.99
107_K	158_K	1.437	0.99
192_A	195_M	1.435	0.99
173_N	176_D	1.434	0.99
52_Y	156_K	1.415	0.99
149_L	152_I	1.409	0.99
86_S	95_P	1.383	0.99
54_T	156_K	1.374	0.99
125_E	136_L	1.370	0.99
182_E	186_N	1.350	0.99
11_N	14_E	1.350	0.99
168_L	195_M	1.340	0.99
106_G	157_I	1.321	0.99
100_Q	198_L	1.303	0.99
98_N	169_S	1.298	0.99
77_F	104_M	1.277	0.99
145_L	148_E	1.276	0.99
54_T	122_I	1.271	0.99
174_E	178_M	1.269	0.99
46_K	51_Y	1.260	0.99
87_S	131_R	1.242	0.98
50_H	158_K	1.228	0.98
14_E	17_N	1.225	0.98
55_G	155_F	1.208	0.98
176_D	179_N	1.200	0.98
51_Y	159_V	1.195	0.98
72_D	105_Y	1.194	0.98
188_E	193_K	1.190	0.98
117_A	121_T	1.175	0.98
111_L	115_E	1.169	0.98
196_A	199_M	1.163	0.97
20_Q	126_K	1.162	0.97
185_Q	196_A	1.158	0.97
45_N	122_I	1.153	0.97
19_V	162_I	1.149	0.97
147_S	150_K	1.139	0.97
24_F	81_H	1.139	0.97
40_L	57_F	1.116	0.97
142_P	146_E	1.104	0.97
39_H	76_M	1.102	0.97
53_I	77_F	1.099	0.96
54_T	119_E	1.083	0.96
19_V	25_G	1.074	0.96
12_A	16_W	1.065	0.96
33_G	66_T	1.064	0.96
148_E	151_G	1.063	0.96
46_K	49_D	1.054	0.95
181_I	185_Q	1.053	0.95
74_L	105_Y	1.048	0.95
183_Q	186_N	1.042	0.95
195_M	198_L	1.017	0.95
30_T	35_P	1.001	0.94
16_W	51_Y	0.999	0.94
16_W	46_K	0.994	0.94
23_S	127_Y	0.994	0.94
185_Q	197_E	0.993	0.94
53_I	104_M	0.989	0.94
59_Y	112_E	0.989	0.94
72_D	161_D	0.987	0.94
64_W	153_V	0.981	0.93
83_Y	128_E	0.979	0.93
168_L	199_M	0.975	0.93
107_K	160_E	0.967	0.93
119_E	123_M	0.965	0.93
189_N	192_A	0.960	0.93
169_S	172_R	0.956	0.92
43_G	119_E	0.950	0.92
57_F	63_Q	0.947	0.92
29_T	38_T	0.938	0.92
119_E	122_I	0.938	0.92
141_S	144_L	0.937	0.92
121_T	137_W	0.937	0.92
44_F	51_Y	0.935	0.92
88_W	184_L	0.934	0.92
3_I	165_A	0.930	0.91
92_E	139_K	0.929	0.91
89_Y	180_V	0.907	0.90
79_G	100_Q	0.894	0.90
92_E	141_S	0.893	0.90
19_V	77_F	0.890	0.90
52_Y	158_K	0.882	0.89
121_T	125_E	0.880	0.89
35_P	72_D	0.872	0.89
43_G	126_K	0.863	0.88
22_N	81_H	0.856	0.88
125_E	137_W	0.854	0.88
45_N	54_T	0.850	0.87
49_D	52_Y	0.850	0.87
29_T	66_T	0.849	0.87
58_A	61_N	0.837	0.86
120_L	149_L	0.832	0.86
144_L	148_E	0.826	0.86
100_Q	168_L	0.823	0.86
59_Y	153_V	0.823	0.86
90_S	179_N	0.822	0.85
115_E	156_K	0.818	0.85
104_M	164_A	0.810	0.85
19_V	186_N	0.808	0.84
193_K	196_A	0.808	0.84
25_G	55_G	0.807	0.84
90_S	176_D	0.806	0.84
5_K	8_K	0.796	0.84
73_V	108_A	0.782	0.83
131_R	134_P	0.781	0.82
45_N	48_D	0.778	0.82
3_I	163_Q	0.773	0.82
61_N	99_Y	0.772	0.82
9_V	15_I	0.772	0.82
24_F	77_F	0.772	0.82
36_I	66_T	0.771	0.82
29_T	73_V	0.766	0.81
115_E	119_E	0.766	0.81
118_E	121_T	0.765	0.81
82_A	192_A	0.764	0.81
189_N	193_K	0.762	0.81
25_G	75_V	0.759	0.81
85_S	183_Q	0.758	0.81
104_M	159_V	0.751	0.80
7_F	170_Q	0.749	0.80
25_G	77_F	0.734	0.78
84_I	180_V	0.733	0.78
94_V	148_E	0.732	0.78
116_L	120_L	0.732	0.78
187_E	193_K	0.729	0.78
80_P	100_Q	0.728	0.78
190_P	193_K	0.727	0.78
15_I	102_V	0.725	0.77
2_Y	165_A	0.723	0.77
23_S	77_F	0.723	0.77
38_T	101_A	0.721	0.77
137_W	140_L	0.720	0.77
85_S	128_E	0.718	0.77
83_Y	86_S	0.717	0.77
108_A	158_K	0.711	0.76
147_S	151_G	0.711	0.76
39_H	147_S	0.710	0.76
28_V	37_A	0.709	0.76
37_A	76_M	0.705	0.76
82_A	187_E	0.699	0.75
116_L	119_E	0.697	0.75
26_T	39_H	0.697	0.75
28_V	74_L	0.686	0.74
18_F	24_F	0.685	0.73
92_E	124_L	0.675	0.72
4_P	61_N	0.672	0.72
123_M	127_Y	0.666	0.71
63_Q	66_T	0.662	0.71
182_E	185_Q	0.662	0.71
116_L	152_I	0.660	0.71
72_D	107_K	0.659	0.71
148_E	171_N	0.654	0.70
188_E	200_E	0.651	0.70
112_E	116_L	0.649	0.69
105_Y	163_Q	0.647	0.69
181_I	200_E	0.646	0.69
102_V	164_A	0.645	0.69
112_E	115_E	0.644	0.69
89_Y	96_T	0.642	0.69
37_A	103_H	0.635	0.68
15_I	166_Y	0.635	0.68
168_L	198_L	0.630	0.67
31_E	66_T	0.628	0.67
94_V	151_G	0.628	0.67
3_I	105_Y	0.626	0.67
68_E	71_E	0.626	0.67
117_A	149_L	0.625	0.66
9_V	164_A	0.622	0.66
13_E	16_W	0.616	0.65
26_T	37_A	0.612	0.65
64_W	110_M	0.612	0.65
140_L	145_L	0.608	0.64
13_E	17_N	0.608	0.64
91_R	176_D	0.603	0.64
177_Y	199_M	0.601	0.63
45_N	49_D	0.597	0.63
90_S	180_V	0.594	0.63
60_G	81_H	0.594	0.63
116_L	149_L	0.593	0.62
174_E	177_Y	0.592	0.62
27_V	40_L	0.591	0.62
89_Y	170_Q	0.591	0.62
16_W	50_H	0.588	0.62
124_L	139_K	0.585	0.61
59_Y	150_K	0.584	0.61
110_M	153_V	0.583	0.61
63_Q	172_R	0.583	0.61
106_G	160_E	0.580	0.61
110_M	155_F	0.579	0.61
44_F	159_V	0.576	0.60
5_K	151_G	0.575	0.60
55_G	77_F	0.574	0.60
103_H	163_Q	0.573	0.60
18_F	22_N	0.572	0.60
28_V	35_P	0.572	0.60
118_E	197_E	0.571	0.60
8_K	133_N	0.570	0.59
18_F	25_G	0.569	0.59
77_F	102_V	0.569	0.59
159_V	162_I	0.568	0.59
41_P	152_I	0.567	0.59
85_S	89_Y	0.563	0.58
180_V	184_L	0.560	0.58
5_K	13_E	0.558	0.58
37_A	78_Q	0.557	0.58
2_Y	6_Y	0.554	0.57
60_G	166_Y	0.554	0.57
30_T	76_M	0.553	0.57
24_F	39_H	0.552	0.57
15_I	162_I	0.550	0.57
148_E	172_R	0.550	0.57
99_Y	165_A	0.546	0.56
16_W	104_M	0.546	0.56
10_T	112_E	0.545	0.56
24_F	99_Y	0.541	0.55
38_T	115_E	0.538	0.55
22_N	77_F	0.538	0.55
181_I	196_A	0.535	0.55
85_S	199_M	0.535	0.55
115_E	154_G	0.534	0.55
86_S	135_V	0.534	0.55
9_V	18_F	0.533	0.54
30_T	33_G	0.532	0.54
3_I	38_T	0.529	0.54
84_I	181_I	0.529	0.54
48_D	54_T	0.527	0.54
43_G	122_I	0.524	0.53
2_Y	152_I	0.524	0.53
114_D	117_A	0.520	0.53
10_T	160_E	0.520	0.53
118_E	125_E	0.519	0.52
150_K	153_V	0.518	0.52
117_A	145_L	0.517	0.52
124_L	148_E	0.517	0.52
86_S	124_L	0.515	0.52
117_A	137_W	0.515	0.52
78_Q	85_S	0.514	0.52
85_S	168_L	0.513	0.52
13_E	70_C	0.513	0.52
191_N	195_M	0.513	0.52
117_A	124_L	0.512	0.52
72_D	108_A	0.511	0.51
51_Y	54_T	0.510	0.51
30_T	85_S	0.509	0.51
47_K	160_E	0.509	0.51
89_Y	179_N	0.509	0.51
35_P	42_L	0.508	0.51
169_S	180_V	0.507	0.51
25_G	76_M	0.507	0.51
16_W	164_A	0.507	0.51
91_R	172_R	0.506	0.51
18_F	155_F	0.504	0.50
26_T	101_A	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ol5A	2	0.8937	100	0.346	Contact Map
2vpaA	2	0.8502	100	0.618	Contact Map
2furA	2	0.8937	99.9	0.629	Contact Map
2fg9A	4	0.744	99.9	0.638	Contact Map
2htiA	2	0.6039	99.9	0.66	Contact Map
3u5wA	2	0.5942	99.8	0.731	Contact Map
2hq9A	2	0.6377	99.7	0.737	Contact Map
3cp3A	2	0.6087	99.7	0.756	Contact Map
2aq6A	2	0.6618	99.5	0.777	Contact Map
2asfA	2	0.5942	99.5	0.779	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0105 seconds.