YSZB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YSZB - UPF0735 ACT domain-containing protein YszB

UniProt:	P21204	Sequences: MKEETFYLVREDVLPDAMRKTLEVKKLLDRKKADSVADAVQKVDLSRSAFYKYRDAVFPFYTMVKEQIITLFFHLEDRSGALSQLLQAVADSGSNVLSIHQTIPLQGRANVTLSISTSAMEEDIHTLMNKLRKFDFVEKVEILGSGA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (141)
Sequences:	472 (329)
Seq/√Len:	27.7

BACSU - YSZB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_K	50_F	3.732	1.00
105_L	144_G	3.328	1.00
17_A	21_T	3.322	1.00
81_A	136_F	2.943	1.00
16_D	20_K	2.902	1.00
123_D	126_T	2.765	1.00
23_E	26_K	2.762	1.00
21_T	45_L	2.635	0.99
78_R	135_D	2.362	0.99
24_V	33_A	2.300	0.98
13_V	56_A	2.207	0.98
89_V	113_L	2.069	0.97
49_A	100_H	1.923	0.95
21_T	106_Q	1.881	0.95
24_V	50_F	1.874	0.95
25_K	48_S	1.825	0.94
106_Q	144_G	1.819	0.94
60_F	107_G	1.791	0.93
18_M	21_T	1.772	0.93
9_V	14_L	1.751	0.92
71_L	117_T	1.750	0.92
9_V	57_V	1.703	0.91
88_A	130_K	1.693	0.91
35_S	144_G	1.677	0.90
25_K	70_T	1.625	0.89
34_D	118_S	1.612	0.89
13_V	17_A	1.559	0.87
82_L	101_Q	1.520	0.85
28_L	36_V	1.510	0.85
72_F	96_V	1.471	0.84
77_D	107_G	1.444	0.82
30_R	96_V	1.394	0.80
92_S	130_K	1.371	0.79
27_L	30_R	1.357	0.78
45_L	49_A	1.355	0.78
24_V	39_A	1.332	0.77
24_V	27_L	1.325	0.76
13_V	49_A	1.322	0.76
78_R	133_K	1.318	0.76
122_E	131_L	1.263	0.73
69_I	143_L	1.219	0.70
50_F	54_R	1.217	0.70
29_D	95_N	1.207	0.69
102_T	114_S	1.201	0.69
128_M	133_K	1.195	0.69
10_R	57_V	1.189	0.68
60_F	112_T	1.188	0.68
84_Q	135_D	1.174	0.67
50_F	130_K	1.166	0.67
13_V	54_R	1.155	0.66
82_L	109_A	1.139	0.65
126_T	129_N	1.137	0.65
74_H	112_T	1.127	0.64
71_L	133_K	1.114	0.63
35_S	116_S	1.091	0.61
80_G	101_Q	1.082	0.61
31_K	34_D	1.067	0.60
21_T	49_A	1.064	0.59
36_V	79_S	1.042	0.58
49_A	54_R	1.039	0.58
25_K	49_A	1.031	0.57
5_T	11_E	1.023	0.56
105_L	110_N	1.016	0.56
17_A	49_A	1.002	0.55
69_I	100_H	1.001	0.55
36_V	40_V	0.993	0.54
96_V	111_V	0.992	0.54
83_S	143_L	0.990	0.54
7_Y	11_E	0.990	0.54
62_T	85_L	0.987	0.54
98_S	109_A	0.984	0.53
70_T	103_I	0.982	0.53
7_Y	57_V	0.980	0.53
38_D	54_R	0.978	0.53
40_V	71_L	0.967	0.52
93_G	121_E	0.967	0.52
84_Q	87_Q	0.956	0.51
42_K	69_I	0.955	0.51
8_L	41_Q	0.947	0.51
40_V	57_V	0.934	0.50
7_Y	22_L	0.932	0.49
59_P	69_I	0.930	0.49
17_A	45_L	0.928	0.49
35_S	77_D	0.923	0.49
7_Y	35_S	0.916	0.48
5_T	113_L	0.916	0.48
129_N	135_D	0.916	0.48
70_T	94_S	0.910	0.48
37_A	68_I	0.907	0.48
62_T	96_V	0.907	0.48
129_N	132_R	0.890	0.46
6_F	74_H	0.889	0.46
48_S	98_S	0.877	0.45
85_L	107_G	0.876	0.45
21_T	37_A	0.875	0.45
88_A	142_I	0.875	0.45
57_V	77_D	0.869	0.45
77_D	116_S	0.867	0.45
74_H	100_H	0.866	0.44
74_H	102_T	0.864	0.44
112_T	141_E	0.860	0.44
71_L	140_V	0.853	0.43
48_S	70_T	0.847	0.43
48_S	52_K	0.840	0.42
37_A	100_H	0.836	0.42
15_P	85_L	0.835	0.42
79_S	90_A	0.833	0.42
58_F	131_L	0.832	0.42
60_F	90_A	0.827	0.42
24_V	43_V	0.827	0.42
61_Y	144_G	0.822	0.41
49_A	68_I	0.808	0.40
81_A	131_L	0.807	0.40
71_L	75_L	0.805	0.40
89_V	94_S	0.803	0.40
54_R	141_E	0.801	0.40
94_S	136_F	0.796	0.39
55_D	112_T	0.794	0.39
17_A	144_G	0.781	0.38
10_R	102_T	0.771	0.37
68_I	105_L	0.769	0.37
26_K	128_M	0.767	0.37
4_E	129_N	0.758	0.37
96_V	106_Q	0.754	0.36
106_Q	116_S	0.751	0.36
92_S	131_L	0.749	0.36
66_E	83_S	0.745	0.36
19_R	36_V	0.742	0.35
76_E	138_E	0.741	0.35
24_V	133_K	0.741	0.35
24_V	31_K	0.740	0.35
17_A	66_E	0.740	0.35
119_A	134_F	0.737	0.35
107_G	143_L	0.729	0.34
6_F	50_F	0.728	0.34
69_I	117_T	0.714	0.33
63_M	102_T	0.709	0.33
117_T	120_M	0.705	0.33
28_L	70_T	0.704	0.33
120_M	137_V	0.691	0.32
74_H	139_K	0.689	0.32
12_D	144_G	0.685	0.32
23_E	129_N	0.684	0.31
68_I	86_L	0.681	0.31
11_E	49_A	0.681	0.31
28_L	40_V	0.673	0.31
28_L	31_K	0.673	0.31
27_L	33_A	0.667	0.30
77_D	94_S	0.667	0.30
119_A	132_R	0.662	0.30
33_A	43_V	0.659	0.30
125_H	129_N	0.658	0.30
33_A	124_I	0.652	0.29
12_D	56_A	0.648	0.29
9_V	117_T	0.647	0.29
9_V	103_I	0.645	0.29
29_D	56_A	0.644	0.29
27_L	32_K	0.643	0.29
90_A	97_L	0.641	0.29
24_V	44_D	0.641	0.29
44_D	103_I	0.638	0.29
40_V	43_V	0.637	0.28
61_Y	68_I	0.635	0.28
57_V	102_T	0.632	0.28
33_A	42_K	0.632	0.28
66_E	116_S	0.630	0.28
78_R	120_M	0.625	0.28
56_A	100_H	0.625	0.28
88_A	125_H	0.615	0.27
76_E	114_S	0.615	0.27
130_K	135_D	0.613	0.27
62_T	108_R	0.613	0.27
89_V	105_L	0.612	0.27
6_F	26_K	0.606	0.27
19_R	56_A	0.598	0.26
41_Q	118_S	0.596	0.26
88_A	133_K	0.596	0.26
75_L	111_V	0.592	0.26
8_L	29_D	0.588	0.26
37_A	41_Q	0.585	0.25
19_R	49_A	0.585	0.25
40_V	90_A	0.585	0.25
119_A	129_N	0.585	0.25
104_P	109_A	0.584	0.25
68_I	106_Q	0.568	0.24
122_E	126_T	0.568	0.24
88_A	91_D	0.566	0.24
91_D	124_I	0.563	0.24
11_E	144_G	0.563	0.24
27_L	43_V	0.557	0.24
35_S	41_Q	0.557	0.24
83_S	109_A	0.557	0.24
8_L	60_F	0.553	0.24
5_T	93_G	0.552	0.23
38_D	42_K	0.551	0.23
103_I	123_D	0.545	0.23
73_F	77_D	0.542	0.23
93_G	131_L	0.538	0.23
19_R	22_L	0.536	0.23
32_K	83_S	0.534	0.23
36_V	99_I	0.532	0.22
113_L	135_D	0.529	0.22
85_L	130_K	0.529	0.22
101_Q	109_A	0.524	0.22
24_V	138_E	0.523	0.22
59_P	107_G	0.522	0.22
10_R	28_L	0.513	0.21
14_L	117_T	0.511	0.21
83_S	94_S	0.510	0.21
95_N	101_Q	0.509	0.21
44_D	77_D	0.508	0.21
22_L	136_F	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fgcA	2	0.5442	99.3	0.771	Contact Map
2pc6A	2	0.5442	98.7	0.819	Contact Map
2f1fA	4	0.5374	98.6	0.822	Contact Map
2ko1A	2	0.551	98.6	0.822	Contact Map
1y7pA	5	0.5374	98.6	0.824	Contact Map
1zpvA	3	0.551	98.4	0.836	Contact Map
2dtjA	4	0.6327	98.1	0.847	Contact Map
2lvwA	2	0.585	98	0.852	Contact Map
3s1tA	2	0.6259	97.9	0.853	Contact Map
2dt9A	2	0.619	97.9	0.856	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.