FLIJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIJ - Flagellar FliJ protein

UniProt:	P20487	Sequences: MAYQFRFQKLLELKENEKDQSLSEYQQSVSEFENVAEKLYENMSKKELLEQNKEKKLKSGMSVQEMRHYQQFVSNLDNTIYHYQKLVIMKRNQMNQKQEILTEKNIEVKKFEKMREKQFKMFALEDKAAEMKEMDDISIKQFMIQGH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (144)
Sequences:	115 (105)
Seq/√Len:	8.8

BACSU - FLIJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_L	114_M	4.130	0.98
36_A	116_E	3.360	0.94
34_N	142_F	2.559	0.81
43_M	90_K	2.448	0.77
91_R	94_M	2.272	0.72
40_Y	60_G	2.169	0.68
98_Q	102_T	2.104	0.66
3_Y	115_R	2.024	0.62
32_F	94_M	1.969	0.60
106_I	109_K	1.933	0.59
28_S	65_E	1.922	0.58
5_F	115_R	1.913	0.58
44_S	90_K	1.896	0.57
123_A	137_I	1.867	0.56
87_V	94_M	1.830	0.54
44_S	84_Q	1.828	0.54
43_M	91_R	1.811	0.53
73_V	136_D	1.801	0.53
8_Q	87_V	1.791	0.53
37_E	75_N	1.790	0.53
109_K	141_Q	1.699	0.49
84_Q	107_E	1.649	0.47
84_Q	91_R	1.644	0.46
28_S	94_M	1.635	0.46
48_L	123_A	1.594	0.44
43_M	94_M	1.580	0.44
20_Q	51_Q	1.579	0.44
38_K	103_E	1.574	0.43
32_F	91_R	1.550	0.42
120_K	123_A	1.549	0.42
37_E	67_R	1.548	0.42
19_D	95_N	1.537	0.42
83_Y	86_L	1.528	0.41
44_S	91_R	1.511	0.41
86_L	142_F	1.467	0.39
72_F	87_V	1.457	0.39
127_K	140_K	1.428	0.37
28_S	92_N	1.416	0.37
50_E	98_Q	1.415	0.37
51_Q	90_K	1.392	0.36
51_Q	54_E	1.377	0.35
107_E	110_K	1.372	0.35
66_M	140_K	1.362	0.35
42_N	90_K	1.345	0.34
2_A	10_L	1.324	0.33
29_V	94_M	1.322	0.33
42_N	83_Y	1.317	0.33
40_Y	91_R	1.313	0.33
3_Y	77_D	1.283	0.32
59_S	142_F	1.260	0.31
49_L	78_N	1.259	0.31
9_K	28_S	1.249	0.30
13_L	16_N	1.220	0.29
7_F	140_K	1.215	0.29
7_F	72_F	1.194	0.29
16_N	26_Q	1.192	0.28
40_Y	94_M	1.172	0.28
47_E	91_R	1.164	0.27
37_E	71_Q	1.148	0.27
13_L	26_Q	1.146	0.27
9_K	66_M	1.129	0.26
49_L	104_K	1.121	0.26
36_A	98_Q	1.113	0.26
104_K	108_V	1.104	0.25
134_M	139_I	1.103	0.25
14_K	138_S	1.102	0.25
40_Y	44_S	1.100	0.25
14_K	30_S	1.082	0.25
69_Y	85_K	1.080	0.25
44_S	136_D	1.080	0.25
24_E	45_K	1.067	0.24
50_E	127_K	1.063	0.24
31_E	34_N	1.063	0.24
125_E	128_A	1.062	0.24
8_Q	97_K	1.056	0.24
64_Q	67_R	1.048	0.24
16_N	24_E	1.044	0.24
13_L	57_L	1.036	0.23
128_A	132_K	1.035	0.23
34_N	103_E	1.033	0.23
100_I	144_I	1.024	0.23
7_F	130_E	1.020	0.23
27_Q	92_N	1.019	0.23
22_L	105_N	1.008	0.22
67_R	83_Y	0.982	0.22
18_K	25_Y	0.974	0.21
76_L	139_I	0.956	0.21
11_L	115_R	0.948	0.21
32_F	43_M	0.918	0.20
76_L	138_S	0.911	0.20
6_R	105_N	0.909	0.20
21_S	34_N	0.908	0.20
17_E	130_E	0.903	0.19
33_E	91_R	0.895	0.19
5_F	22_L	0.890	0.19
32_F	36_A	0.885	0.19
15_E	114_M	0.885	0.19
123_A	136_D	0.883	0.19
9_K	109_K	0.877	0.19
87_V	105_N	0.867	0.19
90_K	142_F	0.866	0.19
120_K	129_A	0.859	0.18
7_F	69_Y	0.858	0.18
44_S	60_G	0.855	0.18
84_Q	110_K	0.854	0.18
78_N	118_Q	0.852	0.18
105_N	115_R	0.851	0.18
18_K	111_F	0.844	0.18
32_F	90_K	0.840	0.18
45_K	132_K	0.837	0.18
65_E	115_R	0.837	0.18
28_S	40_Y	0.832	0.18
42_N	109_K	0.823	0.17
13_L	71_Q	0.820	0.17
138_S	141_Q	0.804	0.17
11_L	112_E	0.797	0.17
72_F	76_L	0.791	0.17
119_F	122_F	0.790	0.17
105_N	118_Q	0.789	0.17
41_E	130_E	0.789	0.17
85_K	139_I	0.779	0.16
14_K	143_M	0.771	0.16
58_K	124_L	0.770	0.16
3_Y	65_E	0.769	0.16
91_R	110_K	0.767	0.16
13_L	133_E	0.755	0.16
22_L	106_I	0.755	0.16
59_S	99_E	0.750	0.16
8_Q	12_E	0.748	0.16
33_E	110_K	0.745	0.16
41_E	68_H	0.742	0.16
60_G	77_D	0.740	0.15
44_S	142_F	0.735	0.15
9_K	107_E	0.733	0.15
91_R	112_E	0.732	0.15
28_S	51_Q	0.731	0.15
25_Y	113_K	0.729	0.15
32_F	110_K	0.721	0.15
41_E	116_E	0.712	0.15
25_Y	110_K	0.711	0.15
33_E	44_S	0.710	0.15
31_E	127_K	0.709	0.15
3_Y	68_H	0.706	0.15
35_V	116_E	0.703	0.15
45_K	72_F	0.688	0.14
50_E	54_E	0.681	0.14
128_A	137_I	0.679	0.14
6_R	75_N	0.677	0.14
43_M	84_Q	0.676	0.14
85_K	104_K	0.670	0.14
96_Q	142_F	0.666	0.14
60_G	114_M	0.662	0.14
31_E	48_L	0.660	0.14
92_N	141_Q	0.658	0.14
14_K	139_I	0.655	0.14
64_Q	99_E	0.654	0.14
5_F	122_F	0.653	0.14
61_M	126_D	0.647	0.14
90_K	94_M	0.633	0.13
84_Q	94_M	0.627	0.13
26_Q	131_M	0.623	0.13
15_E	113_K	0.623	0.13
28_S	35_V	0.619	0.13
40_Y	47_E	0.619	0.13
3_Y	122_F	0.618	0.13
33_E	112_E	0.613	0.13
125_E	129_A	0.611	0.13
6_R	115_R	0.607	0.13
47_E	94_M	0.605	0.13
33_E	84_Q	0.603	0.13
34_N	119_F	0.599	0.13
3_Y	118_Q	0.597	0.13
2_A	28_S	0.596	0.13
8_Q	95_N	0.595	0.12
12_E	87_V	0.594	0.12
51_Q	121_M	0.593	0.12
63_V	116_E	0.591	0.12
67_R	75_N	0.590	0.12
15_E	66_M	0.589	0.12
36_A	91_R	0.586	0.12
33_E	43_M	0.584	0.12
68_H	74_S	0.583	0.12
62_S	129_A	0.581	0.12
50_E	137_I	0.580	0.12
110_K	113_K	0.575	0.12
31_E	82_H	0.573	0.12
49_L	60_G	0.570	0.12
42_N	74_S	0.569	0.12
9_K	84_Q	0.568	0.12
104_K	122_F	0.568	0.12
65_E	124_L	0.564	0.12
19_D	96_Q	0.563	0.12
134_M	144_I	0.559	0.12
3_Y	87_V	0.556	0.12
38_K	68_H	0.542	0.12
47_E	84_Q	0.542	0.12
37_E	86_L	0.540	0.11
137_I	140_K	0.536	0.11
96_Q	139_I	0.536	0.11
88_I	140_K	0.534	0.11
51_Q	120_K	0.531	0.11
56_K	60_G	0.525	0.11
7_F	85_K	0.524	0.11
13_L	74_S	0.522	0.11
18_K	66_M	0.517	0.11
36_A	50_E	0.516	0.11
42_N	66_M	0.516	0.11
103_E	117_K	0.515	0.11
10_L	106_I	0.513	0.11
53_K	118_Q	0.512	0.11
82_H	129_A	0.510	0.11
64_Q	103_E	0.506	0.11
44_S	111_F	0.503	0.11
90_K	140_K	0.502	0.11
19_D	55_K	0.501	0.11
5_F	105_N	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ajwA	2	0.9116	99.9	0.56	Contact Map
3k29A	1	0.9796	99.4	0.71	Contact Map
4mh6A	1	0.898	14.4	0.944	Contact Map
3ojaB	1	0.7755	9	0.949	Contact Map
4jpsB	1	0.7415	8.5	0.95	Contact Map
4nswA	2	0.9116	6.4	0.953	Contact Map
2q12A	2	0.7483	4.9	0.955	Contact Map
4p3fA	2	0.4082	4.8	0.955	Contact Map
2yy0A	6	0.3537	4.2	0.957	Contact Map
1pd7B	1	0.1633	3.9	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.