TRPF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TRPF - N-(5'-phosphoribosyl)anthranilate isomerase

UniProt:	P20167	Sequences: MKKPALKYCGIRSLKDLQLAAESQADYLGFIFAESKRKVSPEDVKKWLNQVRVEKQVAGVFVNESIETMSRIAKSLKLDVIQLHGDEKPADAAALRKLTGCEIWKALHHQDNTTQEIARFKDNVDGFVIDSSVKGSRGGTGVAFSWECVPEYQQAAIGKRCFIAGGVNPDSITRLLKWQPEGIDLASGIEKNGQKDQNLMRLLEERMNRYVSISE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	215 (197)
Sequences:	3781 (3031)
Seq/√Len:	215.9

ECOLI - TRPC
BACSU - TRPF
HALSA - TRPF
SULSO - TRPF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_G	78_L	3.649	1.00
64_E	68_T	2.921	1.00
13_S	16_D	2.887	1.00
8_Y	189_I	2.858	1.00
17_L	47_W	2.813	1.00
191_K	196_D	2.724	1.00
33_A	38_K	2.643	1.00
31_I	186_A	2.176	1.00
63_N	86_D	2.145	1.00
6_L	204_E	2.102	1.00
162_F	182_G	2.063	1.00
80_V	104_W	2.008	1.00
23_S	200_M	1.992	1.00
18_Q	50_Q	1.977	1.00
33_A	62_V	1.968	1.00
185_L	203_L	1.928	1.00
11_I	17_L	1.898	1.00
48_L	57_V	1.876	1.00
65_S	68_T	1.854	1.00
69_M	91_D	1.848	1.00
40_S	43_D	1.839	1.00
146_W	175_L	1.807	1.00
58_A	80_V	1.796	1.00
185_L	189_I	1.730	1.00
31_I	60_V	1.725	1.00
108_H	132_S	1.713	1.00
168_N	188_G	1.679	1.00
63_N	87_E	1.612	1.00
87_E	105_K	1.597	1.00
8_Y	200_M	1.594	1.00
201_R	205_E	1.579	1.00
104_W	126_G	1.569	1.00
20_A	200_M	1.563	1.00
30_F	57_V	1.558	1.00
83_L	95_L	1.555	1.00
32_F	44_V	1.555	1.00
43_D	46_K	1.552	1.00
109_H	148_C	1.534	1.00
32_F	59_G	1.509	1.00
56_Q	79_D	1.504	1.00
173_T	206_R	1.497	1.00
189_I	200_M	1.447	1.00
19_L	197_Q	1.436	1.00
73_A	81_I	1.423	1.00
36_K	192_N	1.416	1.00
61_F	69_M	1.403	1.00
91_D	95_L	1.400	1.00
61_F	72_I	1.398	1.00
5_A	27_Y	1.392	1.00
172_I	183_I	1.384	1.00
163_I	175_L	1.381	1.00
66_I	91_D	1.362	1.00
73_A	101_C	1.357	1.00
88_K	91_D	1.335	1.00
45_K	75_S	1.328	1.00
21_A	55_K	1.309	1.00
173_T	177_K	1.289	1.00
183_I	203_L	1.285	1.00
104_W	162_F	1.282	1.00
57_V	79_D	1.281	1.00
62_V	137_R	1.279	1.00
198_N	202_L	1.274	1.00
198_N	201_R	1.274	1.00
13_S	194_Q	1.273	1.00
64_E	69_M	1.269	1.00
129_I	161_C	1.266	1.00
45_K	49_N	1.241	1.00
126_G	162_F	1.241	1.00
27_Y	56_Q	1.239	1.00
25_A	204_E	1.230	1.00
174_R	177_K	1.221	1.00
134_K	140_T	1.219	1.00
27_Y	162_F	1.216	1.00
6_L	208_N	1.210	1.00
107_L	127_F	1.208	1.00
61_F	78_L	1.191	1.00
14_L	50_Q	1.188	1.00
202_L	206_R	1.187	1.00
16_D	197_Q	1.177	1.00
167_V	183_I	1.176	1.00
34_E	38_K	1.174	1.00
172_I	203_L	1.164	1.00
93_A	123_N	1.164	1.00
20_A	25_A	1.163	1.00
163_I	178_W	1.156	1.00
116_E	119_R	1.144	1.00
32_F	61_F	1.141	1.00
41_P	72_I	1.137	1.00
80_V	102_E	1.110	1.00
48_L	76_L	1.108	1.00
19_L	23_S	1.105	1.00
108_H	137_R	1.100	1.00
71_R	75_S	1.092	1.00
33_A	36_K	1.090	1.00
167_V	203_L	1.085	1.00
143_A	171_S	1.076	1.00
110_Q	132_S	1.072	1.00
109_H	129_I	1.060	1.00
89_P	120_F	1.045	1.00
83_L	103_I	1.044	1.00
19_L	200_M	1.043	1.00
23_S	201_R	1.038	1.00
131_S	140_T	1.035	1.00
204_E	207_M	1.033	1.00
172_I	176_L	1.027	1.00
83_L	87_E	1.026	1.00
42_E	75_S	1.019	1.00
205_E	209_R	1.000	1.00
20_A	28_L	0.990	1.00
14_L	18_Q	0.977	1.00
86_D	137_R	0.972	1.00
17_L	28_L	0.972	1.00
63_N	137_R	0.970	1.00
21_A	52_R	0.968	1.00
176_L	207_M	0.957	1.00
71_R	74_K	0.952	1.00
61_F	64_E	0.951	1.00
122_D	159_K	0.950	1.00
68_T	71_R	0.948	1.00
26_D	208_N	0.948	1.00
91_D	94_A	0.946	1.00
5_A	181_E	0.945	1.00
8_Y	204_E	0.939	1.00
191_K	199_L	0.931	0.99
12_R	194_Q	0.928	0.99
21_A	51_V	0.927	0.99
23_S	204_E	0.926	0.99
5_A	182_G	0.925	0.99
64_E	91_D	0.913	0.99
145_S	148_C	0.906	0.99
22_E	197_Q	0.900	0.99
12_R	16_D	0.892	0.99
69_M	81_I	0.885	0.99
135_G	140_T	0.885	0.99
12_R	43_D	0.878	0.99
19_L	201_R	0.873	0.99
124_V	127_F	0.872	0.99
66_I	94_A	0.871	0.99
104_W	128_V	0.863	0.99
129_I	149_V	0.860	0.99
85_G	105_K	0.859	0.99
176_L	183_I	0.856	0.99
113_T	116_E	0.855	0.99
169_P	202_L	0.854	0.99
69_M	95_L	0.853	0.99
39_V	43_D	0.851	0.99
202_L	205_E	0.845	0.99
117_I	127_F	0.845	0.99
66_I	70_S	0.845	0.99
206_R	209_R	0.840	0.99
63_N	105_K	0.838	0.99
86_D	108_H	0.835	0.99
4_P	207_M	0.831	0.99
51_V	57_V	0.831	0.99
44_V	76_L	0.829	0.99
19_L	22_E	0.827	0.99
6_L	207_M	0.824	0.99
14_L	43_D	0.823	0.99
73_A	77_K	0.816	0.99
175_L	178_W	0.812	0.99
46_K	49_N	0.808	0.99
51_V	55_K	0.806	0.98
185_L	207_M	0.806	0.98
110_Q	113_T	0.805	0.98
22_E	201_R	0.801	0.98
15_K	18_Q	0.794	0.98
81_I	95_L	0.785	0.98
189_I	203_L	0.780	0.98
197_Q	201_R	0.779	0.98
18_Q	22_E	0.775	0.98
27_Y	80_V	0.770	0.98
89_P	93_A	0.768	0.98
161_C	180_P	0.766	0.98
63_N	85_G	0.764	0.98
196_D	199_L	0.763	0.98
118_A	121_K	0.762	0.98
41_P	45_K	0.762	0.98
32_F	78_L	0.759	0.98
48_L	77_K	0.758	0.98
65_S	91_D	0.757	0.98
172_I	206_R	0.756	0.98
171_S	175_L	0.751	0.98
136_S	140_T	0.750	0.98
52_R	55_K	0.749	0.98
7_K	10_G	0.747	0.98
92_A	103_I	0.746	0.97
5_A	56_Q	0.745	0.97
26_D	204_E	0.739	0.97
167_V	185_L	0.737	0.97
200_M	204_E	0.737	0.97
41_P	71_R	0.736	0.97
12_R	192_N	0.735	0.97
16_D	194_Q	0.732	0.97
27_Y	104_W	0.731	0.97
28_L	55_K	0.729	0.97
143_A	146_W	0.727	0.97
137_R	140_T	0.727	0.97
14_L	46_K	0.725	0.97
14_L	47_W	0.725	0.97
66_I	95_L	0.724	0.97
164_A	187_S	0.713	0.97
185_L	188_G	0.707	0.97
121_K	158_G	0.705	0.96
114_T	117_I	0.704	0.96
67_E	70_S	0.702	0.96
92_A	124_V	0.701	0.96
191_K	194_Q	0.700	0.96
72_I	76_L	0.698	0.96
11_I	28_L	0.697	0.96
132_S	140_T	0.696	0.96
167_V	175_L	0.696	0.96
149_V	161_C	0.683	0.96
131_S	144_F	0.681	0.96
176_L	180_P	0.676	0.96
17_L	51_V	0.675	0.96
32_F	38_K	0.670	0.95
170_D	202_L	0.670	0.95
95_L	103_I	0.670	0.95
70_S	100_G	0.667	0.95
34_E	68_T	0.667	0.95
80_V	126_G	0.661	0.95
17_L	30_F	0.660	0.95
38_K	41_P	0.660	0.95
190_E	195_K	0.658	0.95
41_P	75_S	0.657	0.95
149_V	153_Q	0.652	0.95
17_L	21_A	0.652	0.95
16_D	200_M	0.652	0.95
102_E	125_D	0.651	0.95
61_F	81_I	0.646	0.94
109_H	144_F	0.643	0.94
161_C	178_W	0.642	0.94
23_S	197_Q	0.641	0.94
16_D	20_A	0.637	0.94
199_L	202_L	0.636	0.94
153_Q	161_C	0.635	0.94
33_A	137_R	0.632	0.94
89_P	123_N	0.632	0.94
59_G	72_I	0.632	0.94
67_E	71_R	0.629	0.93
115_Q	118_A	0.621	0.93
5_A	26_D	0.621	0.93
20_A	24_Q	0.617	0.93
30_F	48_L	0.617	0.93
11_I	20_A	0.616	0.93
117_I	129_I	0.612	0.93
87_E	91_D	0.611	0.92
30_F	44_V	0.609	0.92
183_I	204_E	0.608	0.92
27_Y	58_A	0.602	0.92
70_S	74_K	0.599	0.92
56_Q	80_V	0.598	0.92
203_L	207_M	0.597	0.92
81_I	101_C	0.596	0.92
56_Q	102_E	0.596	0.92
139_G	187_S	0.591	0.91
144_F	149_V	0.591	0.91
12_R	193_G	0.590	0.91
70_S	73_A	0.577	0.90
143_A	174_R	0.576	0.90
63_N	83_L	0.575	0.90
57_V	78_L	0.570	0.90
70_S	95_L	0.567	0.89
128_V	162_F	0.567	0.89
147_E	150_P	0.566	0.89
18_Q	21_A	0.562	0.89
108_H	138_G	0.562	0.89
24_Q	52_R	0.561	0.89
37_R	190_E	0.556	0.89
4_P	182_G	0.552	0.88
32_F	35_S	0.550	0.88
103_I	124_V	0.548	0.88
186_A	203_L	0.546	0.88
127_F	159_K	0.544	0.87
170_D	199_L	0.543	0.87
169_P	206_R	0.542	0.87
106_A	128_V	0.541	0.87
64_E	72_I	0.540	0.87
167_V	188_G	0.534	0.86
161_C	181_E	0.525	0.86
13_S	200_M	0.525	0.86
21_A	25_A	0.522	0.85
186_A	200_M	0.519	0.85
172_I	185_L	0.518	0.85
139_G	166_G	0.517	0.85
107_L	129_I	0.516	0.85
32_F	72_I	0.515	0.84
169_P	188_G	0.512	0.84
149_V	152_Y	0.511	0.84
30_F	41_P	0.509	0.84
63_N	91_D	0.506	0.83
47_W	50_Q	0.505	0.83
117_I	120_F	0.502	0.83
130_D	141_G	0.502	0.83
17_L	50_Q	0.500	0.83
27_Y	55_K	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v5xA	2	0.9163	100	0.121	Contact Map
4aajA	1	0.8651	100	0.138	Contact Map
1nsjA	2	0.9302	100	0.226	Contact Map
1piiA	1	0.9163	100	0.248	Contact Map
4wuiA	1	0.9256	100	0.294	Contact Map
3ctlA	4	0.9302	99.9	0.662	Contact Map
3ovpA	2	0.9395	99.9	0.673	Contact Map
2tpsA	1	0.9442	99.9	0.68	Contact Map
2fliA	5	0.9209	99.8	0.698	Contact Map
1xi3A	2	0.8977	99.8	0.715	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.