TAL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TAL - Transaldolase

UniProt:	P19669	Sequences: MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVISLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	212 (204)
Sequences:	3741 (2000)
Seq/√Len:	140.1

ECOLI - FSAB FSAA TALB TALA
BACSU - TAL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_K	101_L	6.292	1.00
63_K	66_E	4.651	1.00
68_I	97_A	3.017	1.00
45_R	49_D	2.780	1.00
67_M	85_I	2.544	1.00
95_V	107_V	2.457	1.00
9_N	35_E	2.445	1.00
204_E	208_A	2.385	1.00
149_K	153_D	2.360	1.00
149_K	161_I	2.323	1.00
15_E	191_H	2.270	1.00
116_A	148_V	2.205	1.00
23_A	121_R	2.190	1.00
87_M	110_I	2.170	1.00
96_R	100_D	2.168	1.00
64_A	93_K	2.058	1.00
65_E	69_E	2.055	1.00
201_K	205_Q	2.030	1.00
97_A	101_L	1.998	1.00
135_D	171_H	1.953	1.00
30_S	209_D	1.933	1.00
188_K	192_A	1.856	1.00
93_K	96_R	1.780	1.00
64_A	97_A	1.759	1.00
127_V	152_F	1.681	1.00
85_I	98_L	1.678	1.00
46_E	49_D	1.628	1.00
61_S	66_E	1.623	1.00
62_L	90_D	1.620	1.00
14_R	18_E	1.592	1.00
113_A	151_I	1.590	1.00
99_T	125_T	1.576	1.00
125_T	160_Q	1.553	1.00
72_K	97_A	1.539	1.00
11_D	14_R	1.538	1.00
71_G	98_L	1.534	1.00
85_I	95_V	1.517	1.00
69_E	73_E	1.517	1.00
198_L	202_G	1.516	1.00
62_L	203_I	1.514	1.00
57_A	74_L	1.498	1.00
142_L	175_A	1.492	1.00
68_I	94_A	1.480	1.00
32_V	40_F	1.449	1.00
41_H	73_E	1.427	1.00
143_D	147_E	1.420	1.00
202_G	206_F	1.389	1.00
64_A	90_D	1.388	1.00
62_L	207_L	1.386	1.00
56_S	106_N	1.357	1.00
120_A	155_H	1.353	1.00
205_Q	208_A	1.344	1.00
59_V	67_M	1.339	1.00
72_K	103_I	1.328	1.00
172_V	189_V	1.324	1.00
15_E	19_L	1.305	1.00
37_N	43_R	1.295	1.00
200_D	204_E	1.289	1.00
12_E	187_L	1.287	1.00
9_N	12_E	1.287	1.00
134_L	139_H	1.267	1.00
113_A	147_E	1.249	1.00
73_E	76_K	1.248	1.00
58_E	130_F	1.246	1.00
92_L	118_L	1.242	1.00
163_A	166_I	1.242	1.00
60_I	207_L	1.240	1.00
146_S	150_Q	1.240	1.00
201_K	204_E	1.234	1.00
114_N	173_T	1.226	1.00
64_A	68_I	1.221	1.00
198_L	206_F	1.218	1.00
140_N	143_D	1.191	1.00
71_G	83_V	1.183	1.00
16_A	187_L	1.167	0.99
160_Q	182_I	1.166	0.99
117_L	151_I	1.161	0.99
71_G	85_I	1.155	0.99
106_N	128_S	1.146	0.99
47_I	51_V	1.137	0.99
75_A	103_I	1.137	0.99
170_Q	174_E	1.135	0.99
14_R	46_E	1.127	0.99
105_T	125_T	1.127	0.99
185_M	190_I	1.126	0.99
150_Q	154_I	1.125	0.99
55_V	78_A	1.114	0.99
87_M	107_V	1.112	0.99
142_L	174_E	1.107	0.99
199_T	202_G	1.097	0.99
115_Q	199_T	1.093	0.99
18_E	93_K	1.087	0.99
120_A	152_F	1.086	0.99
135_D	141_G	1.080	0.99
162_I	182_I	1.080	0.99
89_S	194_T	1.075	0.99
104_K	125_T	1.071	0.99
197_P	206_F	1.051	0.99
5_V	190_I	1.047	0.99
40_F	210_W	1.043	0.99
44_L	57_A	1.040	0.99
90_D	93_K	1.039	0.99
68_I	72_K	1.024	0.99
151_I	155_H	1.023	0.99
39_S	42_D	1.022	0.99
10_I	43_R	0.996	0.98
65_E	97_A	0.992	0.98
120_A	151_I	0.988	0.98
132_G	167_R	0.982	0.98
192_A	195_K	0.981	0.98
43_R	46_E	0.978	0.98
22_L	190_I	0.970	0.98
82_T	126_Y	0.967	0.98
75_A	81_I	0.962	0.98
41_H	45_R	0.960	0.98
121_R	157_L	0.959	0.98
44_L	81_I	0.955	0.98
143_D	146_S	0.955	0.98
196_H	200_D	0.950	0.98
95_V	105_T	0.950	0.98
64_A	94_A	0.943	0.98
32_V	43_R	0.941	0.98
34_K	188_K	0.939	0.98
75_A	104_K	0.938	0.98
163_A	175_A	0.931	0.97
136_D	167_R	0.931	0.97
42_D	78_A	0.929	0.97
175_A	180_A	0.929	0.97
87_M	95_V	0.927	0.97
204_E	207_L	0.925	0.97
109_L	130_F	0.923	0.97
69_E	72_K	0.921	0.97
37_N	46_E	0.918	0.97
57_A	81_I	0.918	0.97
172_V	185_M	0.907	0.97
139_H	170_Q	0.906	0.97
36_A	43_R	0.904	0.97
109_L	202_G	0.880	0.96
131_L	141_G	0.876	0.96
12_E	191_H	0.875	0.96
48_T	55_V	0.871	0.96
68_I	98_L	0.870	0.96
187_L	191_H	0.870	0.96
56_S	128_S	0.866	0.96
163_A	178_R	0.861	0.96
146_S	178_R	0.861	0.96
107_V	124_A	0.858	0.96
66_E	69_E	0.856	0.96
132_G	136_D	0.855	0.96
36_A	39_S	0.854	0.96
133_R	165_S	0.850	0.96
89_S	191_H	0.849	0.96
5_V	16_A	0.848	0.96
106_N	130_F	0.848	0.96
97_A	100_D	0.846	0.96
58_E	128_S	0.844	0.96
71_G	75_A	0.842	0.95
169_P	192_A	0.837	0.95
110_I	152_F	0.835	0.95
106_N	109_L	0.833	0.95
129_P	148_V	0.832	0.95
197_P	201_K	0.822	0.95
67_M	94_A	0.822	0.95
40_F	44_L	0.822	0.95
16_A	191_H	0.813	0.95
72_K	76_K	0.806	0.94
165_S	184_T	0.806	0.94
12_E	15_E	0.800	0.94
84_K	184_T	0.799	0.94
68_I	71_G	0.788	0.94
191_H	195_K	0.783	0.93
10_I	46_E	0.773	0.93
17_N	44_L	0.773	0.93
148_V	152_F	0.772	0.93
134_L	144_L	0.772	0.93
198_L	201_K	0.771	0.93
30_S	34_K	0.765	0.93
137_I	197_P	0.762	0.92
74_L	77_I	0.761	0.92
196_H	206_F	0.759	0.92
197_P	202_G	0.759	0.92
11_D	15_E	0.756	0.92
113_A	117_L	0.754	0.92
76_K	101_L	0.754	0.92
13_I	47_I	0.748	0.92
196_H	199_T	0.747	0.92
87_M	92_L	0.745	0.92
14_R	50_V	0.736	0.91
58_E	106_N	0.734	0.91
134_L	137_I	0.733	0.91
110_I	127_V	0.726	0.90
20_G	194_T	0.723	0.90
20_G	191_H	0.722	0.90
88_T	203_I	0.715	0.90
32_V	37_N	0.715	0.90
169_P	173_T	0.712	0.90
169_P	189_V	0.711	0.90
149_K	181_H	0.710	0.90
28_N	108_T	0.708	0.89
151_I	154_I	0.703	0.89
149_K	178_R	0.695	0.88
121_R	155_H	0.693	0.88
48_T	78_A	0.688	0.88
99_T	104_K	0.686	0.88
56_S	130_F	0.685	0.88
147_E	150_Q	0.685	0.88
140_N	174_E	0.683	0.88
10_I	37_N	0.682	0.88
8_A	27_T	0.679	0.87
146_S	174_E	0.677	0.87
98_L	101_L	0.676	0.87
111_F	202_G	0.673	0.87
70_E	73_E	0.663	0.86
75_A	83_V	0.662	0.86
15_E	18_E	0.659	0.86
19_L	194_T	0.656	0.85
128_S	202_G	0.655	0.85
19_L	190_I	0.652	0.85
152_F	159_T	0.648	0.85
75_A	79_P	0.648	0.85
150_Q	153_D	0.647	0.85
17_N	50_V	0.643	0.84
89_S	118_L	0.641	0.84
72_K	98_L	0.641	0.84
163_A	183_G	0.639	0.84
25_V	47_I	0.638	0.84
32_V	44_L	0.637	0.84
117_L	155_H	0.635	0.84
104_K	126_Y	0.634	0.83
63_K	69_E	0.631	0.83
26_T	184_T	0.628	0.83
137_I	201_K	0.626	0.83
27_T	31_L	0.622	0.82
37_N	42_D	0.621	0.82
85_I	94_A	0.617	0.82
47_I	50_V	0.615	0.82
74_L	81_I	0.611	0.81
24_G	29_P	0.608	0.81
88_T	91_G	0.606	0.81
153_D	174_E	0.605	0.81
54_S	82_T	0.604	0.80
32_V	35_E	0.599	0.80
34_K	205_Q	0.594	0.79
3_F	193_L	0.593	0.79
196_H	202_G	0.591	0.79
205_Q	209_D	0.587	0.79
111_F	130_F	0.584	0.78
19_L	191_H	0.578	0.78
84_K	108_T	0.575	0.77
82_T	105_T	0.575	0.77
48_T	80_N	0.573	0.77
6_D	26_T	0.572	0.77
48_T	81_I	0.571	0.77
12_E	19_L	0.569	0.76
52_K	78_A	0.569	0.76
58_E	109_L	0.568	0.76
84_K	165_S	0.568	0.76
30_S	33_A	0.564	0.76
28_N	164_A	0.561	0.75
106_N	202_G	0.561	0.75
34_K	209_D	0.560	0.75
130_F	167_R	0.560	0.75
124_A	157_L	0.558	0.75
145_I	180_A	0.556	0.75
4_F	106_N	0.554	0.75
17_N	22_L	0.553	0.74
4_F	82_T	0.550	0.74
88_T	97_A	0.550	0.74
147_E	173_T	0.549	0.74
120_A	157_L	0.549	0.74
15_E	194_T	0.549	0.74
109_L	128_S	0.548	0.74
91_G	94_A	0.545	0.73
15_E	89_S	0.544	0.73
117_L	154_I	0.542	0.73
202_G	205_Q	0.542	0.73
201_K	206_F	0.541	0.73
10_I	55_V	0.539	0.72
130_F	164_A	0.537	0.72
166_I	171_H	0.536	0.72
168_H	171_H	0.535	0.72
45_R	48_T	0.534	0.72
191_H	194_T	0.534	0.72
45_R	77_I	0.534	0.72
144_L	148_V	0.533	0.72
46_E	50_V	0.529	0.71
172_V	183_G	0.528	0.71
116_A	152_F	0.527	0.71
33_A	209_D	0.525	0.71
25_V	44_L	0.524	0.70
54_S	104_K	0.524	0.70
48_T	79_P	0.523	0.70
16_A	22_L	0.523	0.70
128_S	184_T	0.522	0.70
110_I	115_Q	0.520	0.70
69_E	76_K	0.519	0.70
54_S	126_Y	0.518	0.70
8_A	43_R	0.518	0.70
61_S	70_E	0.513	0.69
164_A	184_T	0.513	0.69
56_S	109_L	0.511	0.69
85_I	91_G	0.510	0.68
131_L	163_A	0.509	0.68
31_L	132_G	0.508	0.68
115_Q	129_P	0.502	0.67
10_I	13_I	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3r8rA	5	1	100	0.015	Contact Map
1wx0A	6	0.9575	100	0.019	Contact Map
1vpxA	6	0.9953	100	0.024	Contact Map
3s1xA	6	0.9953	100	0.028	Contact Map
1l6wA	6	0.9953	100	0.03	Contact Map
3cwnA	2	0.9717	100	0.164	Contact Map
3cq0A	2	0.9717	100	0.168	Contact Map
3m16A	2	0.9717	100	0.172	Contact Map
3tkfA	2	0.9717	100	0.173	Contact Map
3hjzA	1	0.9717	100	0.176	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.