MTRB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MTRB - Transcription attenuation protein MtrB

UniProt:	P19466	Sequences: MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	75 (69)
Sequences:	182 (74)
Seq/√Len:	8.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_V	63_I	4.043	0.98
10_V	55_I	2.517	0.80
64_Q	70_M	2.438	0.78
62_L	69_E	2.135	0.68
21_V	28_T	2.119	0.67
15_V	72_S	2.012	0.63
21_V	31_K	1.864	0.57
35_S	66_A	1.736	0.51
11_V	65_T	1.728	0.51
17_D	50_E	1.579	0.44
12_I	35_S	1.530	0.42
31_K	35_S	1.499	0.41
15_V	71_K	1.466	0.40
33_H	52_T	1.456	0.39
13_K	55_I	1.436	0.38
62_L	71_K	1.398	0.37
9_F	64_Q	1.381	0.36
43_V	46_A	1.373	0.36
43_V	72_S	1.336	0.34
45_I	64_Q	1.317	0.34
28_T	51_H	1.266	0.32
8_D	17_D	1.251	0.31
16_E	44_I	1.247	0.31
15_V	62_L	1.240	0.31
28_T	66_A	1.233	0.30
16_E	37_K	1.224	0.30
7_S	28_T	1.203	0.29
11_V	67_Y	1.182	0.29
9_F	62_L	1.144	0.27
6_S	29_D	1.144	0.27
7_S	66_A	1.136	0.27
25_T	33_H	1.123	0.26
25_T	32_F	1.113	0.26
63_I	72_S	1.109	0.26
17_D	72_S	1.105	0.26
20_N	67_Y	1.097	0.26
20_N	35_S	1.073	0.25
20_N	66_A	1.065	0.25
10_V	72_S	1.062	0.24
35_S	44_I	1.059	0.24
33_H	44_I	1.057	0.24
16_E	28_T	1.052	0.24
5_H	71_K	1.052	0.24
17_D	69_E	1.047	0.24
13_K	41_G	1.019	0.23
62_L	72_S	1.006	0.23
9_F	66_A	0.955	0.21
6_S	62_L	0.936	0.21
41_G	73_E	0.932	0.21
30_T	39_D	0.876	0.19
7_S	21_V	0.869	0.19
57_V	63_I	0.854	0.18
64_Q	69_E	0.842	0.18
25_T	67_Y	0.837	0.18
11_V	51_H	0.808	0.17
26_R	53_S	0.804	0.17
6_S	60_E	0.798	0.17
16_E	57_V	0.796	0.17
6_S	70_M	0.770	0.16
12_I	69_E	0.765	0.16
46_A	65_T	0.754	0.16
15_V	45_I	0.746	0.16
43_V	57_V	0.743	0.16
26_R	58_R	0.730	0.15
5_H	10_V	0.725	0.15
8_D	62_L	0.724	0.15
40_K	66_A	0.720	0.15
7_S	10_V	0.713	0.15
7_S	70_M	0.708	0.15
15_V	21_V	0.696	0.15
18_G	53_S	0.689	0.15
10_V	57_V	0.669	0.14
44_I	52_T	0.622	0.13
45_I	57_V	0.619	0.13
17_D	70_M	0.619	0.13
28_T	63_I	0.618	0.13
16_E	32_F	0.609	0.13
61_A	72_S	0.603	0.13
5_H	12_I	0.602	0.13
10_V	44_I	0.599	0.13
37_K	40_K	0.595	0.13
70_M	73_E	0.580	0.12
17_D	66_A	0.570	0.12
6_S	66_A	0.569	0.12
6_S	69_E	0.568	0.12
33_H	67_Y	0.560	0.12
31_K	46_A	0.559	0.12
44_I	63_I	0.558	0.12
29_D	33_H	0.555	0.12
24_L	67_Y	0.547	0.12
7_S	69_E	0.541	0.12
28_T	55_I	0.540	0.12
44_I	60_E	0.539	0.12
41_G	61_A	0.539	0.12
20_N	63_I	0.538	0.12
45_I	71_K	0.531	0.11
15_V	69_E	0.529	0.11
29_D	63_I	0.524	0.11
8_D	22_I	0.516	0.11
44_I	50_E	0.508	0.11
25_T	37_K	0.503	0.11
29_D	44_I	0.503	0.11
32_F	37_K	0.500	0.11
22_I	35_S	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zteA	3	0.9067	100	0.075	Contact Map
1gtfA	3	0.92	100	0.076	Contact Map
3zzsA	3	0.8667	100	0.113	Contact Map
1xgsA	2	0.8133	11.3	0.933	Contact Map
4ft4B	1	1	9.9	0.935	Contact Map
4ipaA	1	0.8533	7.9	0.938	Contact Map
2e9xD	1	0.8267	7.9	0.938	Contact Map
1larA	1	0.4267	7.1	0.939	Contact Map
4dovA	1	1	6.5	0.94	Contact Map
4wxxA	1	0.9733	6.3	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.