ADAB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ADAB - Methylated-DNA--protein-cysteine methyltransferase, inducible

UniProt:	P19220	Sequences: METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEWARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPYGQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTLLLDLEKRASSEMDVPH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (153)
Sequences:	5740 (4357)
Seq/√Len:	352.3

ECOLI - ADA OGT
BACSU - ADAB OGT
SULSO - OGT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_Q	77_R	3.687	1.00
146_G	152_T	3.612	1.00
163_L	167_L	3.274	1.00
94_A	119_K	3.249	1.00
98_A	101_E	2.969	1.00
108_K	116_D	2.913	1.00
111_S	147_K	2.756	1.00
108_K	112_D	2.413	1.00
162_T	166_D	2.404	1.00
88_G	96_W	2.374	1.00
86_Y	139_V	2.284	1.00
111_S	115_N	2.223	1.00
108_K	113_I	2.172	1.00
98_A	116_D	2.084	1.00
98_A	113_I	2.080	1.00
71_Q	76_K	2.059	1.00
25_T	28_G	1.893	1.00
68_E	80_F	1.882	1.00
112_D	115_N	1.818	1.00
89_T	92_Q	1.769	1.00
88_G	92_Q	1.737	1.00
119_K	122_A	1.734	1.00
97_N	100_C	1.671	1.00
102_I	144_V	1.645	1.00
68_E	82_V	1.618	1.00
64_P	68_E	1.608	1.00
136_L	156_G	1.583	1.00
151_L	158_F	1.574	1.00
123_V	127_G	1.570	1.00
92_Q	132_A	1.567	1.00
111_S	123_V	1.550	1.00
95_V	113_I	1.531	1.00
102_I	108_K	1.529	1.00
101_E	116_D	1.518	1.00
98_A	117_I	1.498	1.00
108_K	144_V	1.494	1.00
64_P	67_V	1.470	1.00
65_Y	138_T	1.465	1.00
99_L	130_I	1.453	1.00
163_L	166_D	1.452	1.00
153_G	158_F	1.415	1.00
128_A	131_G	1.410	1.00
166_D	169_K	1.408	1.00
24_S	62_L	1.396	1.00
131_G	152_T	1.365	1.00
22_I	29_L	1.340	1.00
25_T	30_V	1.314	1.00
58_D	63_E	1.284	1.00
93_L	97_N	1.259	1.00
25_T	85_E	1.250	1.00
66_A	70_T	1.243	1.00
131_G	157_G	1.235	1.00
82_V	138_T	1.207	1.00
100_C	139_V	1.200	1.00
86_Y	93_L	1.190	1.00
128_A	152_T	1.163	1.00
130_I	145_I	1.157	1.00
107_T	165_L	1.157	1.00
115_N	120_P	1.152	1.00
67_V	71_Q	1.150	1.00
159_E	162_T	1.150	1.00
128_A	132_A	1.150	1.00
61_K	65_Y	1.141	1.00
97_N	101_E	1.127	1.00
84_V	135_V	1.107	1.00
68_E	81_T	1.075	1.00
86_Y	135_V	1.075	1.00
86_Y	134_P	1.075	1.00
90_Q	93_L	1.074	1.00
152_T	158_F	1.065	1.00
117_I	126_V	1.055	1.00
160_M	163_L	1.053	1.00
69_I	73_L	1.052	1.00
127_G	131_G	1.035	1.00
78_K	104_Y	1.021	1.00
62_L	65_Y	1.001	1.00
72_Y	167_L	0.999	1.00
68_E	78_K	0.995	1.00
70_T	74_E	0.993	1.00
68_E	77_R	0.988	1.00
98_A	108_K	0.976	1.00
130_I	136_L	0.969	1.00
121_A	124_R	0.967	1.00
103_P	106_Q	0.962	1.00
59_D	62_L	0.962	1.00
136_L	160_M	0.954	1.00
24_S	29_L	0.953	1.00
113_I	130_I	0.946	1.00
131_G	155_R	0.944	1.00
61_K	83_P	0.938	1.00
35_Q	38_P	0.936	1.00
33_G	41_E	0.936	1.00
34_S	59_D	0.913	1.00
117_I	122_A	0.912	1.00
91_F	129_A	0.908	1.00
92_Q	96_W	0.908	1.00
23_A	70_T	0.880	1.00
92_Q	128_A	0.863	1.00
90_Q	94_A	0.860	1.00
136_L	155_R	0.858	1.00
91_F	125_A	0.855	1.00
42_L	138_T	0.851	1.00
137_I	167_L	0.846	1.00
91_F	95_V	0.842	1.00
61_K	64_P	0.840	1.00
95_V	117_I	0.833	1.00
166_D	170_R	0.826	1.00
146_G	150_S	0.823	1.00
35_Q	85_E	0.823	1.00
133_N	141_C	0.820	1.00
73_L	167_L	0.819	1.00
18_W	34_S	0.814	1.00
24_S	65_Y	0.813	1.00
94_A	117_I	0.812	1.00
32_V	39_I	0.810	1.00
130_I	154_Y	0.809	1.00
45_W	49_R	0.800	1.00
146_G	153_G	0.782	1.00
63_E	67_V	0.768	1.00
137_I	164_L	0.764	1.00
77_R	80_F	0.762	1.00
122_A	125_A	0.758	1.00
65_Y	68_E	0.754	1.00
146_G	151_L	0.753	1.00
151_L	162_T	0.751	1.00
29_L	34_S	0.748	1.00
99_L	113_I	0.738	1.00
95_V	126_V	0.734	1.00
94_A	97_N	0.733	1.00
111_S	127_G	0.732	1.00
70_T	73_L	0.728	0.99
109_S	147_K	0.724	0.99
108_K	130_I	0.723	0.99
87_A	93_L	0.723	0.99
69_I	137_I	0.717	0.99
32_V	65_Y	0.716	0.99
113_I	127_G	0.708	0.99
96_W	99_L	0.701	0.99
43_F	47_R	0.700	0.99
112_D	116_D	0.697	0.99
27_K	30_V	0.693	0.99
34_S	62_L	0.691	0.99
86_Y	100_C	0.688	0.99
28_G	85_E	0.686	0.99
72_Y	104_Y	0.683	0.99
23_A	30_V	0.683	0.99
135_V	138_T	0.672	0.99
52_G	55_L	0.671	0.99
20_F	32_V	0.666	0.99
135_V	139_V	0.663	0.99
77_R	81_T	0.663	0.99
72_Y	137_I	0.659	0.99
77_R	104_Y	0.658	0.99
69_I	138_T	0.658	0.99
107_T	145_I	0.650	0.99
152_T	155_R	0.649	0.99
32_V	42_L	0.645	0.99
113_I	144_V	0.644	0.99
72_Y	77_R	0.643	0.99
65_Y	82_V	0.642	0.99
107_T	170_R	0.638	0.99
72_Y	80_F	0.638	0.99
113_I	117_I	0.636	0.99
31_F	34_S	0.631	0.99
60_D	63_E	0.625	0.98
33_G	40_E	0.618	0.98
86_Y	96_W	0.615	0.98
67_V	70_T	0.615	0.98
113_I	116_D	0.613	0.98
123_V	128_A	0.607	0.98
133_N	157_G	0.606	0.98
32_V	138_T	0.605	0.98
88_G	93_L	0.604	0.98
104_Y	167_L	0.603	0.98
154_Y	160_M	0.603	0.98
113_I	126_V	0.601	0.98
29_L	45_W	0.600	0.98
39_I	42_L	0.598	0.98
35_Q	40_E	0.597	0.98
21_Y	34_S	0.596	0.98
99_L	141_C	0.588	0.98
85_E	93_L	0.587	0.98
146_G	158_F	0.586	0.98
69_I	72_Y	0.582	0.98
27_K	85_E	0.581	0.98
102_I	130_I	0.578	0.97
136_L	139_V	0.572	0.97
44_E	160_M	0.570	0.97
119_K	123_V	0.569	0.97
64_P	81_T	0.569	0.97
114_A	120_P	0.568	0.97
80_F	104_Y	0.566	0.97
30_V	34_S	0.566	0.97
84_V	100_C	0.565	0.97
71_Q	80_F	0.563	0.97
109_S	146_G	0.562	0.97
47_R	50_F	0.561	0.97
68_E	71_Q	0.560	0.97
49_R	134_P	0.558	0.97
141_C	157_G	0.558	0.97
158_F	162_T	0.553	0.97
109_S	112_D	0.551	0.97
64_P	82_V	0.550	0.97
22_I	31_F	0.545	0.96
40_E	44_E	0.543	0.96
121_A	127_G	0.542	0.96
118_N	121_A	0.542	0.96
18_W	29_L	0.539	0.96
114_A	126_V	0.539	0.96
155_R	160_M	0.538	0.96
145_I	148_N	0.536	0.96
72_Y	75_G	0.536	0.96
68_E	72_Y	0.535	0.96
34_S	38_P	0.532	0.96
152_T	161_K	0.531	0.96
31_F	45_W	0.530	0.96
156_G	160_M	0.529	0.96
69_I	164_L	0.525	0.96
130_I	155_R	0.522	0.95
58_D	61_K	0.519	0.95
38_P	85_E	0.516	0.95
80_F	138_T	0.513	0.95
18_W	27_K	0.513	0.95
162_T	169_K	0.512	0.95
128_A	157_G	0.511	0.95
43_F	136_L	0.510	0.95
39_I	65_Y	0.509	0.95
161_K	165_L	0.505	0.94
94_A	120_P	0.504	0.94
34_S	37_K	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sfeA	1	0.9218	100	0.169	Contact Map
1eh6A	1	0.8994	100	0.198	Contact Map
3l00A	1	0.838	100	0.2	Contact Map
4bhbA	1	0.9162	100	0.209	Contact Map
1wrjA	1	0.8324	100	0.227	Contact Map
2g7hA	1	0.8603	100	0.326	Contact Map
1mgtA	1	0.8659	100	0.343	Contact Map
3gvaA	1	0.5196	100	0.424	Contact Map
2kifA	1	0.514	100	0.426	Contact Map
3ugoA	1	0.4358	67.3	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.