RSBW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RSBW - Serine-protein kinase RsbW

UniProt:	P17904	Sequences: MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYKEDKNGEVSIRFGVFEDRLEVIVADEGDSFDFDQKQQDLGPYTPSHTVDQLSEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (134)
Sequences:	1324 (931)
Seq/√Len:	80.4

BACSU - RSBW SP2AB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_A	58_A	3.209	1.00
83_A	136_T	2.868	1.00
26_L	71_F	2.861	1.00
54_A	67_V	2.804	1.00
30_A	78_L	2.798	1.00
126_E	140_T	2.716	1.00
124_M	127_V	2.604	1.00
26_L	69_I	2.587	1.00
30_A	43_L	2.564	1.00
77_R	140_T	2.533	1.00
62_D	65_G	2.312	1.00
9_E	70_R	2.301	1.00
77_R	142_Y	2.095	1.00
50_A	120_M	2.080	1.00
9_E	68_S	1.980	1.00
11_K	66_E	1.976	1.00
124_M	139_M	1.969	1.00
79_E	138_A	1.960	1.00
43_L	143_L	1.941	1.00
43_L	124_M	1.933	1.00
11_K	68_S	1.907	1.00
94_K	99_G	1.900	1.00
46_A	124_M	1.891	1.00
60_K	87_D	1.822	1.00
120_M	137_V	1.800	1.00
46_A	119_L	1.749	1.00
81_I	138_A	1.716	1.00
7_Y	72_G	1.649	1.00
68_S	83_A	1.613	1.00
72_G	79_E	1.602	1.00
102_T	106_T	1.597	1.00
74_F	77_R	1.520	0.99
125_D	141_K	1.519	0.99
70_R	81_I	1.511	0.99
13_P	66_E	1.502	0.99
60_K	107_V	1.475	0.99
119_L	122_T	1.415	0.99
51_C	67_V	1.398	0.99
128_R	138_A	1.351	0.99
59_Y	65_G	1.330	0.98
69_I	82_V	1.295	0.98
14_A	59_Y	1.278	0.98
8_I	71_F	1.250	0.98
76_D	142_Y	1.223	0.97
36_T	39_E	1.221	0.97
12_V	55_V	1.178	0.97
96_Q	121_E	1.167	0.96
130_Q	136_T	1.164	0.96
107_V	110_L	1.159	0.96
68_S	85_E	1.150	0.96
12_V	67_V	1.143	0.96
55_V	67_V	1.135	0.96
127_V	139_M	1.129	0.96
45_I	123_L	1.123	0.96
134_G	137_V	1.122	0.96
124_M	141_K	1.113	0.95
23_R	42_D	1.094	0.95
14_A	67_V	1.079	0.94
12_V	22_I	1.060	0.94
81_I	136_T	1.059	0.94
90_D	94_K	1.049	0.94
90_D	93_Q	1.038	0.93
23_R	48_S	1.021	0.93
79_E	140_T	0.999	0.92
105_H	108_D	0.997	0.92
40_I	122_T	0.989	0.91
14_A	64_N	0.983	0.91
12_V	69_I	0.976	0.91
16_P	19_V	0.971	0.91
117_L	120_M	0.971	0.91
24_L	28_G	0.953	0.90
10_M	25_T	0.952	0.90
42_D	46_A	0.945	0.89
30_A	35_Y	0.945	0.89
71_F	78_L	0.935	0.89
50_A	82_V	0.932	0.89
23_R	44_K	0.923	0.88
82_V	139_M	0.922	0.88
75_E	133_S	0.920	0.88
129_V	135_V	0.914	0.88
56_Q	113_G	0.902	0.87
13_P	62_D	0.901	0.87
118_Y	122_T	0.900	0.87
14_A	65_G	0.890	0.86
38_D	110_L	0.881	0.86
88_S	135_V	0.853	0.84
37_Y	119_L	0.851	0.84
48_S	135_V	0.842	0.83
27_S	44_K	0.841	0.83
25_T	69_I	0.838	0.83
79_E	130_Q	0.821	0.82
117_L	129_V	0.816	0.81
15_Q	25_T	0.808	0.81
48_S	52_T	0.804	0.80
23_R	135_V	0.801	0.80
8_I	26_L	0.798	0.80
46_A	80_V	0.795	0.80
19_V	48_S	0.793	0.79
130_Q	138_A	0.790	0.79
19_V	35_Y	0.788	0.79
13_P	64_N	0.779	0.78
21_I	33_M	0.773	0.78
77_R	85_E	0.763	0.77
35_Y	143_L	0.758	0.76
84_D	134_G	0.754	0.76
91_F	94_K	0.752	0.76
120_M	139_M	0.748	0.75
7_Y	70_R	0.744	0.75
126_E	142_Y	0.739	0.74
7_Y	60_K	0.735	0.74
64_N	128_R	0.721	0.73
23_R	129_V	0.719	0.72
76_D	92_D	0.718	0.72
14_A	62_D	0.707	0.71
8_I	21_I	0.706	0.71
72_G	77_R	0.704	0.71
26_L	73_V	0.702	0.71
66_E	85_E	0.702	0.71
81_I	87_D	0.701	0.70
80_V	142_Y	0.698	0.70
48_S	89_F	0.697	0.70
43_L	78_L	0.692	0.69
50_A	139_M	0.685	0.69
101_Y	113_G	0.682	0.68
22_I	69_I	0.674	0.67
39_E	141_K	0.659	0.66
27_S	37_Y	0.658	0.66
49_E	116_G	0.653	0.65
49_E	53_N	0.652	0.65
19_V	112_E	0.650	0.65
15_Q	77_R	0.641	0.64
64_N	72_G	0.639	0.63
89_F	92_D	0.638	0.63
40_I	44_K	0.636	0.63
19_V	22_I	0.634	0.63
46_A	139_M	0.633	0.63
25_T	71_F	0.628	0.62
74_F	79_E	0.627	0.62
13_P	30_A	0.619	0.61
96_Q	99_G	0.615	0.60
56_Q	135_V	0.611	0.60
53_N	116_G	0.606	0.59
19_V	44_K	0.606	0.59
13_P	119_L	0.604	0.59
33_M	73_V	0.601	0.59
59_Y	67_V	0.599	0.58
110_L	115_L	0.595	0.58
60_K	64_N	0.593	0.58
107_V	115_L	0.592	0.57
42_D	80_V	0.590	0.57
47_V	82_V	0.587	0.57
93_Q	99_G	0.585	0.57
70_R	83_A	0.582	0.56
45_I	48_S	0.581	0.56
94_K	111_S	0.579	0.56
81_I	128_R	0.579	0.56
34_G	122_T	0.577	0.56
58_A	88_S	0.576	0.55
101_Y	110_L	0.575	0.55
86_G	114_G	0.567	0.54
92_D	95_Q	0.566	0.54
15_Q	64_N	0.566	0.54
75_E	94_K	0.566	0.54
27_S	124_M	0.564	0.54
19_V	39_E	0.562	0.54
19_V	45_I	0.561	0.54
56_Q	110_L	0.559	0.53
7_Y	66_E	0.559	0.53
8_I	20_G	0.559	0.53
57_H	86_G	0.554	0.53
110_L	113_G	0.553	0.52
39_E	47_V	0.553	0.52
39_E	124_M	0.551	0.52
70_R	130_Q	0.551	0.52
24_L	119_L	0.551	0.52
107_V	113_G	0.548	0.52
56_Q	130_Q	0.546	0.52
67_V	82_V	0.546	0.52
113_G	119_L	0.545	0.51
105_H	109_Q	0.543	0.51
76_D	143_L	0.541	0.51
18_Y	44_K	0.538	0.51
16_P	42_D	0.537	0.50
60_K	109_Q	0.536	0.50
50_A	137_V	0.536	0.50
77_R	126_E	0.532	0.50
7_Y	79_E	0.530	0.49
20_G	139_M	0.527	0.49
96_Q	102_T	0.526	0.49
51_C	105_H	0.525	0.49
9_E	87_D	0.522	0.48
34_G	40_I	0.522	0.48
113_G	118_Y	0.515	0.48
7_Y	10_M	0.514	0.47
16_P	45_I	0.509	0.47
17_E	62_D	0.509	0.47
61_E	64_N	0.506	0.46
35_Y	41_E	0.505	0.46
27_S	115_L	0.502	0.46
129_V	134_G	0.501	0.46
75_E	78_L	0.500	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1th8A	2	0.8125	99.8	0.572	Contact Map
3ke6A	2	0.7937	99.8	0.58	Contact Map
4r3aA	1	0.825	99.1	0.722	Contact Map
3ehhA	2	0.725	99	0.738	Contact Map
4r39A	1	0.875	99	0.74	Contact Map
1i58A	2	0.8	98.9	0.743	Contact Map
4bixA	2	0.825	98.9	0.745	Contact Map
3ehgA	1	0.7188	98.9	0.75	Contact Map
3a0rA	2	0.8375	98.8	0.751	Contact Map
4i5sA	2	0.8313	98.8	0.751	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.