YQXD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQXD - UPF0178 protein YqxD

UniProt:	P17868	Sequences: MEGWRITLLNEQEKTIFVDADACPVKDEILQTASEYEVQVLFVASFEHYQLSRSNEEKWKYVDPHKEAADLYIANHVKPGDIVVTQDIGLASLLLNRNVSVMSERGRLYKEDTIDFALEGRHFSGKQRRKGVYAKGPKKLNKEDRERFITLLQKILSNDEGILH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	164 (144)
Sequences:	1445 (1002)
Seq/√Len:	83.5

ECOLI - YAII
BACSU - YQXD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_Y	76_H	3.994	1.00
92_S	96_N	3.124	1.00
94_L	99_V	2.934	1.00
15_T	41_L	2.917	1.00
18_V	29_I	2.618	1.00
72_Y	75_N	2.600	1.00
39_Q	58_K	2.561	1.00
94_L	101_V	2.453	1.00
146_E	150_T	2.389	1.00
103_S	109_Y	2.388	1.00
35_E	153_Q	2.261	1.00
77_V	99_V	2.185	1.00
77_V	83_V	2.166	1.00
30_L	42_F	2.077	1.00
31_Q	149_I	2.062	1.00
127_Q	132_V	1.975	1.00
79_P	98_N	1.890	1.00
83_V	94_L	1.863	1.00
38_V	156_L	1.823	1.00
20_A	42_F	1.756	1.00
29_I	40_V	1.724	1.00
100_S	155_I	1.704	1.00
25_V	140_L	1.698	1.00
86_Q	104_E	1.659	1.00
60_K	72_Y	1.651	1.00
122_H	126_K	1.576	1.00
43_V	69_A	1.568	1.00
36_Y	153_Q	1.567	1.00
131_G	134_A	1.551	1.00
140_L	145_R	1.529	1.00
141_N	144_D	1.525	1.00
37_E	56_E	1.498	0.99
125_G	129_R	1.491	0.99
15_T	39_Q	1.490	0.99
86_Q	103_S	1.456	0.99
41_L	58_K	1.444	0.99
28_E	145_R	1.441	0.99
96_N	115_D	1.425	0.99
71_L	93_L	1.421	0.99
30_L	57_E	1.405	0.99
16_I	33_A	1.376	0.99
16_I	152_L	1.363	0.99
28_E	149_I	1.340	0.99
77_V	94_L	1.334	0.99
34_S	55_N	1.315	0.99
108_L	151_L	1.311	0.98
89_G	118_L	1.294	0.98
151_L	154_K	1.292	0.98
100_S	158_N	1.282	0.98
18_V	42_F	1.275	0.98
92_S	118_L	1.273	0.98
60_K	76_H	1.265	0.98
153_Q	157_S	1.256	0.98
144_D	147_R	1.255	0.98
110_K	113_T	1.237	0.98
65_H	68_A	1.195	0.97
68_A	71_L	1.184	0.97
95_L	113_T	1.161	0.97
16_I	29_I	1.156	0.97
32_T	156_L	1.151	0.97
17_F	41_L	1.145	0.96
143_E	147_R	1.131	0.96
82_I	156_L	1.108	0.96
84_V	102_M	1.091	0.95
126_K	130_K	1.087	0.95
43_V	73_I	1.046	0.94
15_T	78_K	1.045	0.94
15_T	58_K	1.036	0.94
32_T	149_I	1.026	0.93
42_F	51_L	1.022	0.93
101_V	109_Y	1.019	0.93
74_A	97_R	1.019	0.93
119_E	122_H	1.012	0.93
17_F	73_I	1.011	0.93
115_D	122_H	1.007	0.93
134_A	137_P	0.998	0.93
54_S	57_E	0.992	0.92
95_L	114_I	0.973	0.92
67_E	71_L	0.969	0.91
26_K	42_F	0.968	0.91
36_Y	156_L	0.957	0.91
46_F	59_W	0.954	0.91
115_D	119_E	0.947	0.90
101_V	108_L	0.947	0.90
29_I	152_L	0.939	0.90
100_S	108_L	0.937	0.90
124_S	134_A	0.933	0.90
103_S	107_R	0.927	0.89
92_S	115_D	0.910	0.89
47_E	64_P	0.901	0.88
102_M	155_I	0.901	0.88
18_V	26_K	0.899	0.88
43_V	76_H	0.896	0.88
71_L	75_N	0.890	0.87
130_K	133_Y	0.876	0.87
62_V	69_A	0.868	0.86
82_I	108_L	0.865	0.86
142_K	145_R	0.864	0.86
82_I	155_I	0.863	0.86
51_L	59_W	0.850	0.85
40_V	57_E	0.850	0.85
98_N	111_E	0.846	0.85
108_L	155_I	0.845	0.85
116_F	120_G	0.830	0.84
119_E	123_F	0.823	0.83
75_N	93_L	0.802	0.81
83_V	99_V	0.802	0.81
89_G	122_H	0.788	0.80
119_E	126_K	0.774	0.79
126_K	129_R	0.771	0.79
14_K	28_E	0.770	0.79
28_E	36_Y	0.767	0.78
38_V	41_L	0.766	0.78
95_L	122_H	0.764	0.78
43_V	62_V	0.759	0.78
39_Q	56_E	0.744	0.76
28_E	140_L	0.740	0.76
51_L	57_E	0.737	0.76
151_L	155_I	0.737	0.76
62_V	72_Y	0.733	0.75
150_T	154_K	0.729	0.75
154_K	157_S	0.728	0.75
42_F	59_W	0.725	0.74
74_A	94_L	0.719	0.74
17_F	72_Y	0.712	0.73
78_K	97_R	0.712	0.73
22_A	42_F	0.710	0.73
113_T	117_A	0.706	0.72
122_H	130_K	0.705	0.72
95_L	111_E	0.701	0.72
25_V	148_F	0.699	0.72
105_R	131_G	0.698	0.72
32_T	153_Q	0.698	0.72
91_A	109_Y	0.689	0.71
34_S	54_S	0.689	0.71
50_Q	53_R	0.685	0.70
18_V	22_A	0.684	0.70
48_H	59_W	0.682	0.70
84_V	97_R	0.671	0.69
88_I	117_A	0.670	0.69
34_S	53_R	0.670	0.69
44_A	59_W	0.660	0.67
64_P	68_A	0.659	0.67
42_F	57_E	0.653	0.67
20_A	44_A	0.648	0.66
29_I	84_V	0.648	0.66
102_M	151_L	0.644	0.65
110_K	117_A	0.643	0.65
20_A	24_P	0.642	0.65
149_I	153_Q	0.629	0.64
41_L	76_H	0.629	0.64
68_A	93_L	0.628	0.64
120_G	123_F	0.626	0.63
38_V	80_G	0.625	0.63
95_L	99_V	0.613	0.62
45_S	73_I	0.611	0.61
139_K	145_R	0.609	0.61
25_V	28_E	0.609	0.61
123_F	127_Q	0.607	0.61
63_D	72_Y	0.602	0.60
66_K	71_L	0.601	0.60
45_S	68_A	0.597	0.60
17_F	43_V	0.597	0.60
37_E	54_S	0.596	0.60
29_I	105_R	0.594	0.59
32_T	35_E	0.592	0.59
75_N	140_L	0.591	0.59
102_M	108_L	0.590	0.59
142_K	146_E	0.588	0.59
33_A	40_V	0.588	0.59
18_V	23_C	0.586	0.58
67_E	75_N	0.585	0.58
15_T	151_L	0.579	0.57
117_A	122_H	0.579	0.57
37_E	55_N	0.577	0.57
22_A	128_R	0.574	0.57
81_D	152_L	0.573	0.57
88_I	118_L	0.573	0.57
34_S	56_E	0.569	0.56
122_H	129_R	0.567	0.56
79_P	157_S	0.566	0.56
147_R	151_L	0.563	0.55
108_L	154_K	0.560	0.55
45_S	62_V	0.558	0.55
14_K	78_K	0.558	0.55
108_L	158_N	0.554	0.54
88_I	95_L	0.554	0.54
33_A	56_E	0.553	0.54
22_A	50_Q	0.549	0.53
45_S	65_H	0.543	0.53
26_K	44_A	0.542	0.52
29_I	148_F	0.540	0.52
51_L	54_S	0.540	0.52
73_I	90_L	0.539	0.52
22_A	44_A	0.533	0.51
85_T	101_V	0.529	0.51
107_R	120_G	0.526	0.50
102_M	152_L	0.525	0.50
62_V	128_R	0.525	0.50
15_T	76_H	0.524	0.50
31_Q	35_E	0.521	0.50
20_A	52_S	0.512	0.49
22_A	104_E	0.512	0.49
47_E	59_W	0.509	0.48
30_L	52_S	0.509	0.48
115_D	123_F	0.509	0.48
84_V	104_E	0.507	0.48
64_P	67_E	0.506	0.48
47_E	50_Q	0.505	0.48
86_Q	109_Y	0.504	0.47
17_F	77_V	0.504	0.47
15_T	155_I	0.503	0.47
105_R	144_D	0.503	0.47
80_G	97_R	0.501	0.47
39_Q	78_K	0.500	0.47
45_S	67_E	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mj7A	2	0.7256	81.7	0.927	Contact Map
3hblA	4	0.8902	78.2	0.929	Contact Map
3ouzA	2	0.8841	75.2	0.931	Contact Map
2vpqA	2	0.872	64.3	0.936	Contact Map
4qshA	4	0.7561	62	0.937	Contact Map
3votA	1	0.8537	60.3	0.938	Contact Map
3c48A	2	0.9329	58	0.939	Contact Map
4rcnA	6	0.8415	55.7	0.939	Contact Map
2jjmA	4	0.8963	53.2	0.94	Contact Map
4pqgA	2	0.8963	52.4	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.