KBAA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KBAA - KinB-signaling pathway activation protein

UniProt:	P16449	Sequences: MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQIFSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMYVRFLFFGESGESLAGYAWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWFPALRVNDEDWLYLMLFPLMACNAFQLLMLPKFAAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	198 (190)
Sequences:	190 (153)
Seq/√Len:	11.1

BACSU - KBAA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
150_S	189_L	4.882	1.00
9_F	195_F	3.654	0.98
130_F	186_A	3.476	0.98
92_L	148_V	3.329	0.97
9_F	193_P	3.328	0.97
127_L	131_G	3.104	0.96
3_S	7_V	2.980	0.94
131_G	151_L	2.568	0.88
18_A	56_G	2.495	0.87
8_R	12_S	2.264	0.81
146_T	193_P	2.190	0.78
142_S	193_P	2.124	0.76
149_S	160_L	2.056	0.74
137_I	141_Q	1.937	0.69
99_A	155_V	1.905	0.68
2_K	148_V	1.860	0.66
74_H	77_A	1.860	0.66
65_M	72_T	1.857	0.66
125_V	129_I	1.849	0.65
79_E	153_L	1.846	0.65
98_V	160_L	1.824	0.64
90_L	121_A	1.795	0.63
56_G	184_C	1.761	0.61
142_S	146_T	1.703	0.59
12_S	116_S	1.701	0.59
54_G	58_I	1.701	0.59
25_G	52_F	1.664	0.57
24_V	107_F	1.608	0.54
18_A	177_M	1.599	0.54
146_T	149_S	1.599	0.54
60_S	106_R	1.567	0.52
51_W	173_W	1.531	0.50
6_L	99_A	1.526	0.50
77_A	81_L	1.506	0.49
26_F	58_I	1.504	0.49
133_I	183_A	1.486	0.48
22_S	49_L	1.462	0.47
37_F	47_S	1.428	0.45
131_G	155_V	1.420	0.45
18_A	57_M	1.410	0.45
191_M	195_F	1.388	0.44
117_L	134_T	1.351	0.42
22_S	74_H	1.348	0.42
13_I	149_S	1.322	0.40
175_Y	179_F	1.315	0.40
2_K	5_G	1.307	0.40
143_S	146_T	1.300	0.39
16_V	133_I	1.298	0.39
82_R	186_A	1.296	0.39
63_S	147_F	1.291	0.39
79_E	102_L	1.286	0.39
82_R	151_L	1.280	0.38
61_V	186_A	1.276	0.38
107_F	120_Y	1.269	0.38
33_Y	176_L	1.256	0.37
8_R	187_F	1.253	0.37
52_F	63_S	1.248	0.37
25_G	173_W	1.242	0.37
65_M	106_R	1.240	0.37
178_L	182_M	1.237	0.37
77_A	90_L	1.233	0.36
3_S	58_I	1.228	0.36
6_L	60_S	1.222	0.36
78_L	147_F	1.205	0.35
18_A	122_W	1.205	0.35
61_V	64_Q	1.203	0.35
62_I	127_L	1.183	0.34
111_G	115_E	1.179	0.34
106_R	120_Y	1.177	0.34
55_V	173_W	1.174	0.34
3_S	75_R	1.174	0.34
97_F	160_L	1.172	0.34
60_S	177_M	1.167	0.33
115_E	169_N	1.167	0.33
143_S	193_P	1.164	0.33
177_M	184_C	1.148	0.33
101_D	106_R	1.146	0.33
154_M	186_A	1.136	0.32
140_K	151_L	1.119	0.31
56_G	177_M	1.118	0.31
60_S	166_L	1.116	0.31
3_S	54_G	1.096	0.30
43_G	46_F	1.092	0.30
41_E	45_I	1.083	0.30
107_F	195_F	1.082	0.30
4_R	10_F	1.070	0.29
90_L	93_F	1.068	0.29
191_M	194_K	1.064	0.29
34_R	96_L	1.059	0.29
74_H	88_N	1.059	0.29
73_V	191_M	1.052	0.29
134_T	181_L	1.038	0.28
121_A	127_L	1.037	0.28
58_I	167_R	1.032	0.28
77_A	165_A	1.019	0.27
11_F	72_T	1.009	0.27
15_A	157_I	1.009	0.27
5_G	194_K	1.004	0.27
107_F	149_S	1.002	0.27
34_R	117_L	1.001	0.27
60_S	64_Q	0.999	0.27
164_P	177_M	0.998	0.27
9_F	191_M	0.994	0.26
43_G	47_S	0.989	0.26
2_K	73_V	0.980	0.26
62_I	72_T	0.974	0.26
132_V	151_L	0.970	0.26
59_F	177_M	0.964	0.25
13_I	79_E	0.964	0.25
56_G	60_S	0.964	0.25
30_W	41_E	0.962	0.25
133_I	155_V	0.954	0.25
45_I	50_F	0.953	0.25
89_L	174_L	0.950	0.25
125_V	131_G	0.948	0.25
26_F	54_G	0.942	0.25
126_F	194_K	0.934	0.24
15_A	37_F	0.924	0.24
58_I	180_P	0.923	0.24
135_A	191_M	0.912	0.23
57_M	122_W	0.910	0.23
102_L	159_A	0.907	0.23
42_A	151_L	0.896	0.23
118_A	144_K	0.895	0.23
12_S	129_I	0.895	0.23
59_F	104_Y	0.895	0.23
62_I	120_Y	0.895	0.23
43_G	189_L	0.881	0.22
133_I	139_Q	0.879	0.22
69_V	142_S	0.879	0.22
141_Q	194_K	0.875	0.22
3_S	167_R	0.875	0.22
59_F	176_L	0.874	0.22
5_G	193_P	0.867	0.22
8_R	195_F	0.862	0.22
132_V	136_Y	0.862	0.22
161_E	181_L	0.857	0.22
64_Q	68_F	0.853	0.21
107_F	193_P	0.852	0.21
23_I	125_V	0.850	0.21
117_L	131_G	0.849	0.21
188_Q	192_L	0.847	0.21
20_I	140_K	0.839	0.21
24_V	179_F	0.838	0.21
35_G	165_A	0.831	0.21
23_I	140_K	0.820	0.20
12_S	125_V	0.811	0.20
100_F	162_W	0.810	0.20
12_S	137_I	0.807	0.20
16_V	118_A	0.805	0.20
117_L	129_I	0.801	0.20
63_S	73_V	0.801	0.20
119_G	126_F	0.796	0.20
49_L	133_I	0.788	0.19
83_S	103_M	0.785	0.19
90_L	96_L	0.783	0.19
146_T	195_F	0.778	0.19
9_F	72_T	0.778	0.19
143_S	149_S	0.775	0.19
143_S	160_L	0.774	0.19
2_K	179_F	0.773	0.19
39_T	47_S	0.771	0.19
118_A	129_I	0.770	0.19
5_G	9_F	0.765	0.19
16_V	55_V	0.765	0.19
126_F	130_F	0.764	0.19
23_I	118_A	0.749	0.18
6_L	10_F	0.747	0.18
97_F	104_Y	0.743	0.18
65_M	76_F	0.738	0.18
144_K	148_V	0.737	0.18
42_A	145_K	0.737	0.18
59_F	147_F	0.735	0.18
98_V	159_A	0.735	0.18
11_F	46_F	0.734	0.18
14_L	82_R	0.732	0.18
90_L	131_G	0.728	0.18
51_W	74_H	0.726	0.18
92_L	118_A	0.725	0.18
108_L	121_A	0.724	0.18
44_Q	58_I	0.721	0.17
2_K	75_R	0.719	0.17
59_F	174_L	0.718	0.17
74_H	78_L	0.718	0.17
130_F	182_M	0.718	0.17
24_V	129_I	0.717	0.17
118_A	121_A	0.712	0.17
9_F	146_T	0.709	0.17
20_I	24_V	0.704	0.17
73_V	87_W	0.702	0.17
51_W	72_T	0.701	0.17
57_M	136_Y	0.701	0.17
135_A	151_L	0.694	0.17
132_V	165_A	0.692	0.17
6_L	69_V	0.691	0.17
46_F	178_L	0.691	0.17
122_W	137_I	0.690	0.17
10_F	64_Q	0.689	0.17
2_K	6_L	0.686	0.17
26_F	45_I	0.685	0.17
175_Y	194_K	0.676	0.16
124_P	187_F	0.675	0.16
20_I	45_I	0.670	0.16
24_V	118_A	0.669	0.16
19_L	57_M	0.664	0.16
81_L	87_W	0.661	0.16
29_K	48_V	0.661	0.16
17_G	70_F	0.658	0.16
8_R	38_L	0.656	0.16
53_I	144_K	0.653	0.16
26_F	40_F	0.649	0.16
57_M	61_V	0.647	0.16
3_S	195_F	0.646	0.15
146_T	187_F	0.645	0.15
9_F	142_S	0.641	0.15
39_T	125_V	0.640	0.15
99_A	172_D	0.635	0.15
115_E	130_F	0.628	0.15
10_F	143_S	0.627	0.15
50_F	72_T	0.624	0.15
63_S	184_C	0.621	0.15
25_G	51_W	0.616	0.15
17_G	68_F	0.616	0.15
104_Y	107_F	0.610	0.15
90_L	162_W	0.609	0.15
100_F	104_Y	0.608	0.15
122_W	129_I	0.607	0.15
29_K	32_E	0.604	0.14
61_V	165_A	0.604	0.14
77_A	131_G	0.603	0.14
132_V	190_L	0.601	0.14
100_F	166_L	0.599	0.14
142_S	180_P	0.599	0.14
24_V	157_I	0.598	0.14
63_S	177_M	0.595	0.14
37_F	159_A	0.594	0.14
21_T	57_M	0.590	0.14
20_I	183_A	0.588	0.14
163_F	179_F	0.587	0.14
88_N	95_I	0.586	0.14
102_L	119_G	0.585	0.14
4_R	162_W	0.585	0.14
159_A	182_M	0.583	0.14
47_S	105_V	0.583	0.14
47_S	170_D	0.581	0.14
169_N	174_L	0.579	0.14
74_H	169_N	0.577	0.14
97_F	164_P	0.574	0.14
78_L	86_L	0.570	0.14
92_L	151_L	0.568	0.14
61_V	106_R	0.567	0.14
25_G	180_P	0.565	0.14
127_L	145_K	0.563	0.14
19_L	99_A	0.563	0.14
71_L	102_L	0.562	0.13
76_F	164_P	0.559	0.13
55_V	73_V	0.559	0.13
67_F	142_S	0.555	0.13
80_I	109_F	0.547	0.13
10_F	66_G	0.545	0.13
86_L	114_G	0.545	0.13
97_F	193_P	0.542	0.13
68_F	142_S	0.541	0.13
19_L	182_M	0.537	0.13
75_R	147_F	0.536	0.13
105_V	153_L	0.534	0.13
49_L	179_F	0.534	0.13
19_L	34_R	0.533	0.13
174_L	183_A	0.531	0.13
10_F	188_Q	0.529	0.13
16_V	99_A	0.526	0.13
11_F	129_I	0.525	0.13
134_T	154_M	0.523	0.13
45_I	121_A	0.523	0.13
67_F	190_L	0.520	0.13
105_V	125_V	0.519	0.13
105_V	189_L	0.515	0.12
60_S	120_Y	0.514	0.12
4_R	49_L	0.513	0.12
5_G	61_V	0.512	0.12
121_A	157_I	0.508	0.12
38_L	118_A	0.505	0.12
64_Q	106_R	0.505	0.12
56_G	187_F	0.502	0.12
12_S	128_L	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ryoA	1	0.7323	51.6	0.953	Contact Map
2zy9A	2	0.3889	36.9	0.957	Contact Map
4uc1A	3	0.7727	19.8	0.963	Contact Map
4nv5A	1	0.8485	5.7	0.971	Contact Map
3s8fA	1	0.9293	4.2	0.973	Contact Map
2gfpA	2	0.8283	3.6	0.974	Contact Map
3hd7A	1	0.1667	3.4	0.974	Contact Map
4oo9A	1	0.3737	3.2	0.974	Contact Map
2mgyA	1	0.8182	2.5	0.975	Contact Map
4he8L	1	0.4091	2.4	0.976	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.