SP3D - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP3D - Stage III sporulation protein D

UniProt:	P15281	Sequences: MHDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (82)
Sequences:	333 (185)
Seq/√Len:	20.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_K	43_E	3.674	1.00
16_I	41_L	3.043	0.99
63_H	66_I	2.850	0.99
57_K	61_D	2.789	0.99
12_I	37_V	2.714	0.99
49_N	55_E	2.585	0.98
21_K	63_H	2.414	0.97
15_Y	30_F	1.898	0.89
32_V	61_D	1.734	0.84
26_I	41_L	1.724	0.84
10_I	13_G	1.686	0.82
15_Y	26_I	1.685	0.82
55_E	82_D	1.667	0.81
50_P	54_N	1.633	0.80
8_R	40_D	1.623	0.80
17_V	55_E	1.614	0.79
14_K	49_N	1.565	0.77
21_K	66_I	1.565	0.77
7_E	49_N	1.543	0.76
26_I	63_H	1.470	0.72
62_Y	66_I	1.467	0.72
5_I	53_A	1.450	0.71
53_A	56_V	1.396	0.68
20_K	58_E	1.380	0.67
6_K	76_K	1.376	0.67
19_T	62_Y	1.376	0.67
32_V	47_E	1.330	0.64
73_E	77_L	1.278	0.61
2_H	20_K	1.241	0.59
15_Y	21_K	1.220	0.57
42_T	53_A	1.198	0.56
4_Y	53_A	1.123	0.51
31_G	42_T	1.090	0.49
76_K	80_K	1.084	0.49
13_G	17_V	1.074	0.48
12_I	25_V	1.068	0.48
20_K	28_K	1.062	0.47
63_H	73_E	1.060	0.47
40_D	44_R	1.046	0.46
20_K	46_P	1.023	0.45
4_Y	12_I	1.019	0.44
63_H	70_R	0.995	0.43
2_H	6_K	0.924	0.38
10_I	52_L	0.919	0.38
59_I	80_K	0.918	0.38
55_E	58_E	0.904	0.37
51_D	65_S	0.878	0.36
45_L	72_G	0.875	0.35
14_K	54_N	0.868	0.35
64_K	74_A	0.860	0.35
64_K	70_R	0.850	0.34
51_D	82_D	0.850	0.34
33_S	39_K	0.834	0.33
1_M	5_I	0.829	0.33
6_K	73_E	0.823	0.32
14_K	25_V	0.796	0.31
75_T	79_Y	0.793	0.31
12_I	30_F	0.793	0.31
37_V	43_E	0.792	0.31
68_H	75_T	0.791	0.31
20_K	82_D	0.783	0.30
27_A	70_R	0.775	0.30
24_R	35_S	0.764	0.29
35_S	68_H	0.760	0.29
24_R	34_K	0.756	0.29
31_G	59_I	0.754	0.29
60_L	63_H	0.748	0.28
1_M	4_Y	0.738	0.28
47_E	55_E	0.728	0.27
36_T	40_D	0.723	0.27
36_T	78_K	0.721	0.27
2_H	59_I	0.720	0.27
25_V	51_D	0.720	0.27
77_L	82_D	0.720	0.27
1_M	68_H	0.719	0.27
14_K	81_K	0.714	0.26
7_E	58_E	0.709	0.26
38_H	79_Y	0.685	0.25
18_E	80_K	0.679	0.25
5_I	13_G	0.674	0.24
66_I	70_R	0.664	0.24
66_I	79_Y	0.661	0.24
11_K	19_T	0.660	0.24
11_K	14_K	0.659	0.24
74_A	78_K	0.654	0.24
77_L	80_K	0.652	0.23
6_K	49_N	0.648	0.23
25_V	53_A	0.647	0.23
17_V	59_I	0.646	0.23
8_R	36_T	0.643	0.23
57_K	69_L	0.643	0.23
62_Y	77_L	0.632	0.22
47_E	50_P	0.626	0.22
29_E	32_V	0.622	0.22
28_K	50_P	0.616	0.22
19_T	77_L	0.610	0.21
42_T	64_K	0.608	0.21
65_S	74_A	0.606	0.21
46_P	56_V	0.602	0.21
32_V	79_Y	0.601	0.21
31_G	74_A	0.597	0.21
66_I	78_K	0.582	0.20
19_T	47_E	0.570	0.20
17_V	81_K	0.569	0.20
11_K	29_E	0.568	0.20
8_R	44_R	0.565	0.20
7_E	29_E	0.561	0.19
29_E	69_L	0.559	0.19
12_I	65_S	0.559	0.19
19_T	29_E	0.557	0.19
2_H	63_H	0.556	0.19
1_M	44_R	0.555	0.19
19_T	55_E	0.546	0.19
9_T	13_G	0.543	0.19
30_F	79_Y	0.541	0.19
13_G	51_D	0.536	0.18
58_E	62_Y	0.536	0.18
10_I	14_K	0.524	0.18
37_V	45_L	0.521	0.18
60_L	70_R	0.515	0.18
28_K	81_K	0.509	0.17
14_K	17_V	0.508	0.17
6_K	17_V	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l0kA	1	1	99.9	0.458	Contact Map
2heoA	1	0.6129	95.4	0.846	Contact Map
2vxzA	1	0.7957	94.4	0.854	Contact Map
1oyiA	1	0.6667	94.4	0.854	Contact Map
1qpzA	2	0.7742	93.7	0.858	Contact Map
4l5jA	4	0.8065	93.4	0.86	Contact Map
4a0zA	2	0.7312	93	0.862	Contact Map
2o20A	2	0.2688	93	0.862	Contact Map
2w48A	3	0.8172	93	0.862	Contact Map
3h5oA	2	0.2043	92.9	0.863	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.