COTE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COTE - Spore coat protein E

UniProt:	P14016	Sequences: MSEYREIITKAVVAKGRKFTQCTNTISPEKKPSSILGGWIINHKYDAEKIGKTVEIEGYYDINVWYSYADNTKTEVVTERVKYVDVIKLRYRDNNYLDDEHEVIAKVLQQPNCLEVTISPNGNKIVVQAEREFLAEVVGETKVVVEVNPDWEEDDEEDWEDELDEELEDINPEFLVGDPEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	181 (175)
Sequences:	208 (145)
Seq/√Len:	11.0

BACSU - COTE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_V	152_E	3.785	0.99
108_L	134_L	3.272	0.97
159_W	163_L	2.838	0.92
13_V	88_K	2.668	0.90
116_V	129_A	2.550	0.88
40_I	175_L	2.355	0.83
85_D	134_L	2.329	0.82
68_Y	75_E	2.279	0.81
13_V	52_K	2.205	0.78
61_D	67_S	2.115	0.75
10_K	140_E	2.101	0.75
85_D	131_R	2.071	0.74
46_D	57_E	2.038	0.72
64_V	161_D	2.009	0.71
11_A	141_T	1.965	0.70
20_T	85_D	1.898	0.67
56_I	84_V	1.876	0.66
31_K	114_L	1.843	0.64
39_W	42_N	1.840	0.64
38_G	106_K	1.831	0.64
14_A	52_K	1.826	0.64
34_S	47_A	1.804	0.63
77_V	125_I	1.791	0.62
10_K	36_L	1.777	0.61
56_I	104_I	1.765	0.61
105_A	133_F	1.721	0.59
24_N	60_Y	1.694	0.58
95_N	145_V	1.680	0.57
13_V	91_Y	1.631	0.55
125_I	153_E	1.602	0.53
33_S	163_L	1.582	0.52
4_Y	148_N	1.558	0.51
4_Y	77_V	1.538	0.50
60_Y	105_A	1.513	0.49
36_L	41_I	1.511	0.49
146_E	168_E	1.504	0.49
145_V	165_E	1.502	0.48
35_I	174_F	1.453	0.46
54_V	64_V	1.438	0.45
59_Y	135_A	1.428	0.45
109_Q	112_N	1.426	0.45
14_A	23_T	1.426	0.45
99_D	127_V	1.424	0.45
14_A	101_H	1.422	0.45
56_I	167_L	1.421	0.45
52_K	88_K	1.400	0.44
24_N	133_F	1.384	0.43
62_I	77_V	1.378	0.43
38_G	129_A	1.365	0.42
125_I	170_I	1.357	0.42
51_G	55_E	1.356	0.42
150_D	163_L	1.354	0.41
39_W	43_H	1.347	0.41
41_I	73_K	1.345	0.41
115_E	140_E	1.344	0.41
94_N	116_V	1.316	0.40
15_K	73_K	1.314	0.40
72_T	139_G	1.313	0.40
63_N	74_T	1.309	0.39
45_Y	133_F	1.286	0.38
102_E	155_D	1.282	0.38
24_N	105_A	1.279	0.38
44_K	128_Q	1.276	0.38
105_A	108_L	1.253	0.37
18_K	103_V	1.211	0.35
35_I	137_V	1.202	0.35
127_V	140_E	1.191	0.34
34_S	131_R	1.189	0.34
136_E	142_K	1.185	0.34
62_I	170_I	1.182	0.34
77_V	159_W	1.182	0.34
148_N	168_E	1.175	0.33
88_K	134_L	1.171	0.33
44_K	116_V	1.168	0.33
8_I	19_F	1.164	0.33
89_L	93_D	1.154	0.33
119_S	126_V	1.143	0.32
70_D	80_R	1.124	0.31
30_K	160_E	1.101	0.30
158_D	164_D	1.098	0.30
62_I	102_E	1.096	0.30
52_K	133_F	1.088	0.30
75_E	120_P	1.081	0.30
149_P	172_P	1.077	0.29
40_I	117_T	1.068	0.29
49_K	73_K	1.066	0.29
153_E	175_L	1.059	0.29
26_I	110_Q	1.052	0.28
69_A	157_E	1.041	0.28
120_P	126_V	1.034	0.28
24_N	67_S	1.033	0.28
13_V	56_I	1.032	0.28
31_K	94_N	1.013	0.27
3_E	80_R	1.013	0.27
79_E	137_V	1.011	0.27
7_I	18_K	1.002	0.26
44_K	96_Y	0.996	0.26
80_R	147_V	0.994	0.26
15_K	42_N	0.994	0.26
14_A	98_D	0.989	0.26
28_P	55_E	0.987	0.26
167_L	173_E	0.986	0.26
99_D	121_N	0.979	0.26
40_I	90_R	0.977	0.26
155_D	162_E	0.972	0.25
78_T	85_D	0.971	0.25
25_T	32_P	0.965	0.25
171_N	176_V	0.961	0.25
17_R	172_P	0.956	0.25
16_G	42_N	0.949	0.25
54_V	85_D	0.946	0.24
9_T	15_K	0.935	0.24
10_K	41_I	0.928	0.24
63_N	76_V	0.926	0.24
14_A	88_K	0.923	0.24
171_N	177_G	0.923	0.24
169_D	173_E	0.921	0.24
56_I	117_T	0.921	0.24
27_S	147_V	0.911	0.23
24_N	170_I	0.910	0.23
99_D	122_G	0.901	0.23
83_Y	131_R	0.899	0.23
150_D	160_E	0.897	0.23
43_H	83_Y	0.889	0.22
154_D	173_E	0.886	0.22
15_K	39_W	0.881	0.22
106_K	145_V	0.878	0.22
27_S	155_D	0.866	0.22
101_H	116_V	0.865	0.22
42_N	83_Y	0.863	0.22
72_T	75_E	0.849	0.21
35_I	56_I	0.831	0.21
13_V	120_P	0.827	0.20
53_T	171_N	0.817	0.20
23_T	114_L	0.807	0.20
144_V	148_N	0.806	0.20
36_L	140_E	0.786	0.19
93_D	135_A	0.784	0.19
62_I	164_D	0.784	0.19
23_T	156_E	0.777	0.19
100_E	124_K	0.777	0.19
20_T	145_V	0.775	0.19
110_Q	118_I	0.769	0.19
150_D	158_D	0.762	0.18
88_K	171_N	0.754	0.18
84_V	163_L	0.751	0.18
5_R	174_F	0.748	0.18
99_D	162_E	0.747	0.18
91_Y	113_C	0.747	0.18
60_Y	106_K	0.745	0.18
28_P	35_I	0.744	0.18
68_Y	102_E	0.744	0.18
22_C	173_E	0.742	0.18
38_G	104_I	0.740	0.18
166_E	171_N	0.739	0.18
6_E	175_L	0.737	0.18
135_A	175_L	0.736	0.18
90_R	105_A	0.732	0.18
156_E	162_E	0.730	0.18
83_Y	118_I	0.726	0.17
123_N	163_L	0.722	0.17
16_G	113_C	0.716	0.17
8_I	17_R	0.714	0.17
40_I	82_K	0.706	0.17
35_I	118_I	0.704	0.17
53_T	177_G	0.702	0.17
121_N	143_V	0.700	0.17
170_I	177_G	0.698	0.17
4_Y	87_I	0.698	0.17
119_S	164_D	0.689	0.16
30_K	175_L	0.689	0.16
5_R	127_V	0.687	0.16
169_D	177_G	0.679	0.16
105_A	166_E	0.675	0.16
101_H	169_D	0.674	0.16
160_E	173_E	0.669	0.16
17_R	25_T	0.668	0.16
78_T	128_Q	0.666	0.16
40_I	59_Y	0.666	0.16
69_A	135_A	0.666	0.16
48_E	124_K	0.665	0.16
61_D	102_E	0.665	0.16
117_T	177_G	0.663	0.16
162_E	165_E	0.662	0.16
50_I	114_L	0.660	0.16
71_N	127_V	0.659	0.16
56_I	103_V	0.655	0.16
25_T	120_P	0.655	0.16
11_A	67_S	0.653	0.16
169_D	176_V	0.645	0.15
29_E	44_K	0.644	0.15
59_Y	80_R	0.643	0.15
16_G	127_V	0.639	0.15
28_P	51_G	0.637	0.15
35_I	45_Y	0.636	0.15
31_K	150_D	0.636	0.15
48_E	154_D	0.632	0.15
26_I	97_L	0.628	0.15
121_N	126_V	0.623	0.15
57_E	120_P	0.623	0.15
79_E	169_D	0.618	0.15
110_Q	139_G	0.618	0.15
16_G	87_I	0.616	0.15
59_Y	82_K	0.612	0.15
135_A	161_D	0.612	0.15
28_P	93_D	0.611	0.15
168_E	172_P	0.610	0.14
59_Y	157_E	0.607	0.14
24_N	34_S	0.606	0.14
59_Y	97_L	0.605	0.14
17_R	40_I	0.597	0.14
97_L	175_L	0.594	0.14
8_I	145_V	0.592	0.14
85_D	112_N	0.592	0.14
40_I	165_E	0.592	0.14
44_K	150_D	0.584	0.14
16_G	39_W	0.584	0.14
13_V	101_H	0.581	0.14
5_R	47_A	0.580	0.14
131_R	164_D	0.578	0.14
33_S	122_G	0.577	0.14
57_E	173_E	0.576	0.14
54_V	122_G	0.576	0.14
117_T	121_N	0.576	0.14
78_T	110_Q	0.576	0.14
67_S	126_V	0.571	0.14
61_D	83_Y	0.571	0.14
81_V	117_T	0.569	0.14
39_W	83_Y	0.569	0.14
12_V	139_G	0.562	0.13
150_D	162_E	0.561	0.13
44_K	82_K	0.561	0.13
117_T	128_Q	0.561	0.13
170_I	174_F	0.553	0.13
113_C	175_L	0.546	0.13
10_K	73_K	0.546	0.13
50_I	70_D	0.546	0.13
13_V	22_C	0.546	0.13
20_T	48_E	0.544	0.13
120_P	144_V	0.540	0.13
21_Q	89_L	0.539	0.13
30_K	69_A	0.538	0.13
3_E	143_V	0.529	0.13
22_C	91_Y	0.525	0.13
8_I	151_W	0.524	0.13
51_G	167_L	0.524	0.13
70_D	160_E	0.523	0.13
21_Q	54_V	0.522	0.13
127_V	154_D	0.518	0.12
17_R	149_P	0.518	0.12
50_I	128_Q	0.516	0.12
15_K	43_H	0.514	0.12
110_Q	127_V	0.514	0.12
87_I	90_R	0.511	0.12
24_N	131_R	0.509	0.12
85_D	109_Q	0.508	0.12
39_W	132_E	0.506	0.12
94_N	129_A	0.504	0.12
26_I	64_V	0.502	0.12
40_I	129_A	0.502	0.12
26_I	141_T	0.501	0.12
38_G	42_N	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3vu9A	1	0.4144	7.1	0.968	Contact Map
4ewcA	2	0.6188	5	0.97	Contact Map
2ww5A	1	0.3315	4.4	0.971	Contact Map
3wa1A	4	0.3978	4.2	0.971	Contact Map
4exkA	2	0.5856	4	0.972	Contact Map
3n91A	1	0.4972	3.5	0.972	Contact Map
1nh2C	1	0.0221	3	0.973	Contact Map
2jssB	1	0.1989	2.8	0.974	Contact Map
3tndB	3	0.3204	2.7	0.974	Contact Map
4u7aA	1	0	2.7	0.974	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.