TMRB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TMRB - Tunicamycin resistance protein

UniProt:	P12921	Sequences: MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	197 (170)
Sequences:	372 (219)
Seq/√Len:	16.8

BACSU - TMRB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_Y	95_R	4.919	1.00
141_L	149_H	3.553	1.00
83_I	92_I	3.208	0.99
9_F	129_W	2.955	0.98
110_A	152_T	2.841	0.98
66_L	77_L	2.750	0.97
23_R	162_E	2.521	0.96
53_Q	88_Y	2.447	0.95
84_V	137_C	2.395	0.94
16_T	160_V	2.374	0.94
106_F	164_I	2.264	0.92
75_G	165_A	2.229	0.92
83_I	90_N	2.213	0.91
129_W	133_Q	2.183	0.91
112_K	116_L	2.169	0.90
92_I	150_I	1.892	0.83
119_L	127_N	1.889	0.83
110_A	153_D	1.860	0.82
81_M	122_R	1.854	0.82
17_A	78_I	1.760	0.78
9_F	51_D	1.717	0.76
59_R	91_E	1.710	0.76
5_I	109_M	1.668	0.74
110_A	114_T	1.638	0.73
21_H	78_I	1.601	0.71
26_P	76_I	1.599	0.71
123_A	126_K	1.524	0.67
3_I	112_K	1.523	0.67
19_E	22_R	1.447	0.63
3_I	147_E	1.424	0.62
57_L	134_I	1.423	0.62
42_M	49_K	1.423	0.62
112_K	135_D	1.405	0.61
32_P	51_D	1.399	0.60
62_N	65_L	1.397	0.60
3_I	157_I	1.368	0.58
144_P	148_D	1.366	0.58
35_M	106_F	1.351	0.57
16_T	75_G	1.349	0.57
83_I	164_I	1.343	0.57
88_Y	91_E	1.338	0.57
9_F	82_T	1.330	0.56
120_R	130_A	1.326	0.56
29_V	94_G	1.322	0.56
5_I	17_A	1.314	0.55
4_W	91_E	1.314	0.55
25_N	115_L	1.303	0.55
17_A	49_K	1.295	0.54
56_P	79_V	1.276	0.53
21_H	27_S	1.270	0.53
25_N	156_S	1.269	0.53
39_L	136_R	1.261	0.52
128_S	133_Q	1.244	0.51
96_L	103_V	1.232	0.50
65_L	95_R	1.207	0.49
87_E	150_I	1.203	0.49
41_S	54_S	1.194	0.48
20_L	155_L	1.188	0.48
39_L	55_Y	1.184	0.48
13_K	108_L	1.165	0.46
82_T	129_W	1.160	0.46
14_T	87_E	1.159	0.46
18_F	29_V	1.157	0.46
89_F	93_I	1.149	0.46
8_A	30_Y	1.149	0.46
18_F	112_K	1.135	0.45
52_F	129_W	1.134	0.45
132_K	161_A	1.131	0.44
24_L	76_I	1.123	0.44
12_G	108_L	1.109	0.43
11_S	65_L	1.107	0.43
5_I	131_A	1.101	0.43
90_N	94_G	1.097	0.43
119_L	137_C	1.072	0.41
5_I	134_I	1.069	0.41
63_Y	99_E	1.061	0.40
107_T	141_L	1.057	0.40
70_T	101_R	1.049	0.40
158_Q	161_A	1.047	0.40
11_S	121_T	1.037	0.39
115_L	134_I	1.037	0.39
8_A	11_S	1.037	0.39
9_F	127_N	1.035	0.39
122_R	126_K	1.032	0.39
38_A	42_M	1.031	0.39
131_A	134_I	1.025	0.38
27_S	78_I	1.024	0.38
2_I	5_I	1.013	0.38
84_V	107_T	1.012	0.38
119_L	130_A	1.004	0.37
36_G	82_T	1.003	0.37
52_F	82_T	0.999	0.37
97_R	116_L	0.998	0.37
28_Y	77_L	0.995	0.37
70_T	76_I	0.986	0.36
78_I	154_N	0.969	0.35
150_I	155_L	0.949	0.34
35_M	39_L	0.942	0.34
26_P	109_M	0.941	0.34
164_I	167_R	0.938	0.34
25_N	98_Q	0.938	0.34
5_I	36_G	0.934	0.33
89_F	107_T	0.934	0.33
34_K	37_F	0.933	0.33
33_E	118_R	0.930	0.33
106_F	149_H	0.930	0.33
133_Q	136_R	0.924	0.33
24_L	27_S	0.924	0.33
26_P	57_L	0.916	0.32
97_R	113_E	0.916	0.32
53_Q	81_M	0.913	0.32
5_I	15_Q	0.906	0.32
111_S	157_I	0.901	0.32
3_I	163_N	0.896	0.31
40_R	124_E	0.892	0.31
42_M	57_L	0.891	0.31
15_Q	168_A	0.888	0.31
2_I	30_Y	0.884	0.31
146_F	149_H	0.884	0.31
84_V	119_L	0.882	0.31
11_S	115_L	0.880	0.31
125_G	150_I	0.879	0.31
57_L	74_R	0.859	0.30
122_R	130_A	0.858	0.30
46_E	74_R	0.848	0.29
34_K	42_M	0.838	0.29
104_H	121_T	0.834	0.28
84_V	88_Y	0.825	0.28
67_A	115_L	0.824	0.28
13_K	36_G	0.824	0.28
154_N	162_E	0.818	0.28
19_E	130_A	0.811	0.27
96_L	100_G	0.810	0.27
70_T	161_A	0.810	0.27
92_I	99_E	0.809	0.27
36_G	52_F	0.805	0.27
25_N	83_I	0.800	0.27
124_E	130_A	0.794	0.26
114_T	160_V	0.794	0.26
42_M	55_Y	0.792	0.26
111_S	156_S	0.778	0.26
37_F	40_R	0.776	0.26
79_V	101_R	0.775	0.26
23_R	66_L	0.774	0.26
82_T	122_R	0.774	0.26
71_D	79_V	0.773	0.25
33_E	159_D	0.771	0.25
54_S	72_T	0.766	0.25
10_G	130_A	0.762	0.25
156_S	162_E	0.762	0.25
12_G	36_G	0.762	0.25
89_F	122_R	0.761	0.25
114_T	152_T	0.760	0.25
16_T	130_A	0.760	0.25
9_F	53_Q	0.758	0.25
148_D	167_R	0.756	0.25
60_A	94_G	0.754	0.25
29_V	51_D	0.754	0.25
141_L	146_F	0.750	0.24
154_N	164_I	0.747	0.24
17_A	154_N	0.730	0.24
66_L	70_T	0.724	0.23
44_P	116_L	0.724	0.23
127_N	131_A	0.720	0.23
111_S	153_D	0.716	0.23
14_T	117_K	0.716	0.23
61_F	77_L	0.716	0.23
39_L	42_M	0.714	0.23
106_F	113_E	0.712	0.23
89_F	146_F	0.708	0.23
44_P	81_M	0.705	0.23
100_G	103_V	0.705	0.23
114_T	153_D	0.703	0.22
89_F	119_L	0.702	0.22
8_A	137_C	0.701	0.22
93_I	97_R	0.697	0.22
152_T	160_V	0.696	0.22
36_G	108_L	0.688	0.22
29_V	83_I	0.687	0.22
98_Q	159_D	0.686	0.22
45_Q	116_L	0.682	0.22
27_S	113_E	0.679	0.21
160_V	164_I	0.674	0.21
114_T	117_K	0.668	0.21
75_G	103_V	0.668	0.21
110_A	134_I	0.667	0.21
75_G	161_A	0.663	0.21
5_I	63_Y	0.662	0.21
141_L	165_A	0.661	0.21
116_L	131_A	0.658	0.21
11_S	37_F	0.657	0.21
16_T	165_A	0.656	0.21
138_V	153_D	0.655	0.21
78_I	153_D	0.652	0.20
78_I	162_E	0.645	0.20
11_S	61_F	0.635	0.20
17_A	51_D	0.634	0.20
74_R	95_R	0.633	0.20
30_Y	112_K	0.630	0.20
24_L	165_A	0.629	0.20
40_R	52_F	0.627	0.19
153_D	160_V	0.617	0.19
53_Q	129_W	0.612	0.19
82_T	119_L	0.610	0.19
104_H	166_A	0.608	0.19
29_V	99_E	0.607	0.19
13_K	118_R	0.606	0.19
25_N	151_Q	0.598	0.18
37_F	159_D	0.598	0.18
38_A	61_F	0.596	0.18
120_R	166_A	0.594	0.18
53_Q	62_N	0.593	0.18
60_A	64_S	0.591	0.18
101_R	144_P	0.588	0.18
15_Q	109_M	0.587	0.18
113_E	135_D	0.583	0.18
33_E	36_G	0.578	0.18
60_A	72_T	0.577	0.18
30_Y	38_A	0.574	0.18
4_W	59_R	0.570	0.17
26_P	42_M	0.566	0.17
120_R	123_A	0.563	0.17
98_Q	139_E	0.560	0.17
41_S	165_A	0.556	0.17
84_V	136_R	0.555	0.17
54_S	81_M	0.552	0.17
68_S	140_G	0.551	0.17
9_F	128_S	0.549	0.17
12_G	118_R	0.549	0.17
57_L	147_E	0.546	0.17
32_P	81_M	0.543	0.17
43_V	68_S	0.542	0.17
61_F	66_L	0.539	0.16
66_L	96_L	0.539	0.16
8_A	134_I	0.538	0.16
60_A	67_A	0.537	0.16
53_Q	105_H	0.537	0.16
9_F	32_P	0.534	0.16
24_L	57_L	0.530	0.16
74_R	78_I	0.527	0.16
64_S	68_S	0.523	0.16
52_F	122_R	0.519	0.16
51_D	88_Y	0.517	0.16
29_V	44_P	0.516	0.16
42_M	71_D	0.516	0.16
60_A	69_L	0.515	0.16
8_A	97_R	0.511	0.16
54_S	88_Y	0.508	0.15
117_K	154_N	0.507	0.15
66_L	79_V	0.506	0.15
15_Q	131_A	0.505	0.15
30_Y	77_L	0.505	0.15
163_N	167_R	0.504	0.15
47_I	101_R	0.501	0.15
28_Y	69_L	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vliA	2	0.868	100	0.666	Contact Map
1qhxA	4	0.8122	99.6	0.791	Contact Map
2yvuA	2	0.8376	99.6	0.799	Contact Map
2cdnA	1	0.8376	99.6	0.799	Contact Map
1m8pA	5	0.8528	99.5	0.804	Contact Map
2p5tB	1	0.9391	99.5	0.805	Contact Map
2gksA	2	0.8426	99.5	0.806	Contact Map
3a4mA	2	0.9036	99.5	0.808	Contact Map
2iyvA	1	0.8579	99.5	0.809	Contact Map
2rhmA	2	0.8629	99.5	0.811	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.