RS17 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS17 - 30S ribosomal protein S17

UniProt:	P12874	Sequences: MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	87 (79)
Sequences:	2119 (996)
Seq/√Len:	112.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_K	72_T	4.485	1.00
62_K	79_E	3.571	1.00
26_V	43_S	3.128	1.00
23_I	77_L	2.720	1.00
20_D	53_N	2.121	1.00
17_D	56_K	1.984	1.00
64_M	76_R	1.889	1.00
56_K	83_E	1.870	1.00
55_A	77_L	1.782	1.00
30_Y	41_K	1.767	1.00
17_D	57_I	1.755	1.00
46_F	63_I	1.665	1.00
27_V	46_F	1.653	1.00
54_Q	83_E	1.567	1.00
7_R	64_M	1.546	1.00
13_R	60_I	1.518	1.00
66_T	76_R	1.474	1.00
32_K	37_G	1.404	1.00
28_E	41_K	1.395	1.00
19_M	47_K	1.392	1.00
55_A	80_V	1.387	1.00
31_K	42_Y	1.372	1.00
48_A	63_I	1.347	1.00
24_T	47_K	1.338	1.00
64_M	78_V	1.326	1.00
23_I	55_A	1.305	0.99
60_I	82_E	1.276	0.99
54_Q	80_V	1.274	0.99
30_Y	39_R	1.233	0.99
15_V	26_V	1.216	0.99
11_Q	62_K	1.158	0.99
23_I	48_A	1.138	0.99
21_K	51_E	1.126	0.98
9_V	62_K	1.115	0.98
8_K	65_E	1.087	0.98
13_R	26_V	1.031	0.97
11_Q	60_I	1.021	0.97
32_K	39_R	1.016	0.97
62_K	81_V	1.007	0.97
50_D	53_N	1.002	0.97
9_V	64_M	0.988	0.96
48_A	61_V	0.966	0.96
50_D	55_A	0.965	0.96
69_L	76_R	0.962	0.96
77_L	80_V	0.961	0.96
22_T	47_K	0.958	0.96
24_T	45_K	0.953	0.96
10_Y	75_F	0.952	0.96
29_T	39_R	0.948	0.96
15_V	45_K	0.924	0.95
68_P	74_R	0.920	0.95
49_H	73_K	0.913	0.95
25_V	63_I	0.877	0.93
23_I	61_V	0.853	0.92
48_A	77_L	0.850	0.92
9_V	78_V	0.849	0.92
16_S	24_T	0.833	0.91
18_K	57_I	0.817	0.91
26_V	45_K	0.816	0.91
62_K	78_V	0.791	0.89
69_L	74_R	0.785	0.89
25_V	61_V	0.775	0.88
10_Y	63_I	0.774	0.88
13_R	28_E	0.767	0.88
17_D	23_I	0.766	0.88
31_K	39_R	0.761	0.87
66_T	69_L	0.760	0.87
38_K	82_E	0.755	0.87
25_V	48_A	0.749	0.86
33_H	40_V	0.736	0.85
70_S	73_K	0.719	0.84
8_K	74_R	0.710	0.83
10_Y	46_F	0.708	0.83
54_Q	79_E	0.708	0.83
56_K	84_A	0.692	0.82
21_K	50_D	0.663	0.79
35_L	39_R	0.658	0.78
17_D	55_A	0.658	0.78
29_T	44_K	0.644	0.77
49_H	70_S	0.621	0.74
18_K	24_T	0.612	0.73
10_Y	29_T	0.609	0.73
19_M	24_T	0.604	0.72
11_Q	81_V	0.599	0.72
43_S	80_V	0.598	0.72
24_T	72_T	0.596	0.71
7_R	65_E	0.593	0.71
51_E	76_R	0.592	0.71
31_K	84_A	0.589	0.70
24_T	43_S	0.589	0.70
30_Y	40_V	0.587	0.70
34_T	39_R	0.583	0.70
8_K	76_R	0.573	0.68
56_K	59_D	0.571	0.68
31_K	40_V	0.565	0.67
15_V	24_T	0.565	0.67
22_T	73_K	0.562	0.67
12_G	58_G	0.560	0.67
29_T	71_A	0.555	0.66
39_R	44_K	0.553	0.66
13_R	27_V	0.548	0.65
51_E	67_R	0.540	0.64
20_D	50_D	0.538	0.64
28_E	43_S	0.537	0.63
39_R	42_Y	0.536	0.63
7_R	66_T	0.535	0.63
31_K	35_L	0.533	0.63
33_H	38_K	0.532	0.63
8_K	32_K	0.516	0.60
60_I	83_E	0.516	0.60
76_R	84_A	0.511	0.60
13_R	34_T	0.510	0.59
9_V	71_A	0.510	0.59
51_E	77_L	0.510	0.59
17_D	53_N	0.502	0.58
41_K	81_V	0.500	0.58
7_R	76_R	0.500	0.58
30_Y	42_Y	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qd7I	1	0.9425	100	0.148	Contact Map
4tp8Q	1	0.9195	100	0.152	Contact Map
4rb5Q	1	0.9425	100	0.155	Contact Map
3bbnQ	1	0.931	100	0.17	Contact Map
3j20R	1	1	100	0.171	Contact Map
4bpeQ	1	1	100	0.174	Contact Map
3j7aV	1	0.977	100	0.182	Contact Map
5aj3Q	1	1	100	0.186	Contact Map
4ujpM	1	0.977	100	0.189	Contact Map
3j60L	1	0.6782	100	0.195	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.