RL29 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL29 - 50S ribosomal protein L29

UniProt:	P12873	Sequences: MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTVIREREIAANK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	66 (61)
Sequences:	1161 (529)
Seq/√Len:	67.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_K	20_S	2.730	1.00
10_T	13_E	2.465	1.00
11_T	60_R	2.379	1.00
14_I	53_M	2.261	1.00
9_L	17_K	2.238	1.00
58_R	61_E	2.165	1.00
7_R	59_E	2.142	1.00
16_Q	20_S	2.131	1.00
18_V	53_M	1.896	1.00
58_R	62_I	1.861	1.00
42_R	45_E	1.787	1.00
23_E	27_N	1.778	1.00
13_E	16_Q	1.694	0.99
24_E	42_R	1.643	0.99
49_A	52_R	1.599	0.99
24_E	27_N	1.473	0.99
45_E	49_A	1.373	0.98
32_L	43_I	1.370	0.98
21_L	53_M	1.324	0.97
21_L	49_A	1.300	0.97
44_R	48_K	1.291	0.97
31_Q	42_R	1.248	0.96
46_V	50_I	1.229	0.96
56_V	59_E	1.201	0.95
30_F	38_E	1.181	0.95
19_K	23_E	1.168	0.94
11_T	57_I	1.130	0.93
31_Q	36_Q	1.085	0.92
33_A	36_Q	1.008	0.88
15_E	57_I	1.003	0.88
15_E	19_K	0.974	0.86
24_E	30_F	0.920	0.83
22_K	35_G	0.892	0.81
29_R	34_T	0.891	0.81
4_N	8_D	0.873	0.80
6_I	14_I	0.871	0.80
3_A	56_V	0.866	0.79
32_L	35_G	0.857	0.79
12_A	16_Q	0.849	0.78
33_A	42_R	0.838	0.77
36_Q	50_I	0.821	0.76
29_R	33_A	0.818	0.75
27_N	30_F	0.803	0.74
14_I	60_R	0.801	0.74
25_L	47_R	0.790	0.73
25_L	50_I	0.789	0.73
34_T	47_R	0.778	0.72
34_T	52_R	0.776	0.71
35_G	54_K	0.761	0.70
43_I	54_K	0.758	0.70
6_I	56_V	0.758	0.70
31_Q	46_V	0.755	0.69
30_F	42_R	0.752	0.69
14_I	18_V	0.750	0.69
41_A	45_E	0.745	0.68
42_R	46_V	0.744	0.68
21_L	40_T	0.739	0.68
7_R	56_V	0.736	0.67
40_T	54_K	0.717	0.65
2_K	5_E	0.704	0.64
16_Q	19_K	0.704	0.64
22_K	30_F	0.704	0.64
22_K	54_K	0.702	0.64
20_S	23_E	0.700	0.63
9_L	13_E	0.696	0.63
6_I	9_L	0.689	0.62
12_A	56_V	0.667	0.60
49_A	58_R	0.653	0.58
24_E	28_L	0.652	0.58
35_G	38_E	0.643	0.57
11_T	15_E	0.625	0.55
30_F	41_A	0.597	0.51
25_L	39_N	0.587	0.50
3_A	57_I	0.568	0.48
22_K	33_A	0.563	0.47
13_E	17_K	0.557	0.47
33_A	60_R	0.552	0.46
13_E	57_I	0.549	0.46
43_I	56_V	0.549	0.46
32_L	54_K	0.541	0.45
34_T	60_R	0.539	0.45
25_L	30_F	0.537	0.44
54_K	60_R	0.535	0.44
27_N	35_G	0.523	0.43
32_L	58_R	0.523	0.43
21_L	54_K	0.522	0.43
30_F	33_A	0.519	0.42
8_D	58_R	0.508	0.41
17_K	25_L	0.507	0.41
4_N	15_E	0.507	0.41
7_R	49_A	0.503	0.40
6_I	38_E	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bboZ	1	0.9394	99.9	0.184	Contact Map
1r73A	1	1	99.9	0.196	Contact Map
2zjrV	1	0.9848	99.9	0.197	Contact Map
4rb62	1	0.9545	99.9	0.198	Contact Map
3j21W	1	1	99.9	0.201	Contact Map
3j3wX	1	0.9242	99.9	0.203	Contact Map
3j61h	1	1	99.9	0.203	Contact Map
1vx73	1	1	99.9	0.203	Contact Map
4tp9Y	1	0.9545	99.9	0.207	Contact Map
1vq8V	1	0.9394	99.9	0.218	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.