OGT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OGT - Methylated-DNA--protein-cysteine methyltransferase, constitutive

UniProt:	P11742	Sequences: MNYYTTAETPLGELIIAEEEDRITRLFLSQEDWVDWKETVQNTEHKETPNLAEAKQQLQEYFAGERKTFSLPLSQKGTPFQQKVWQALERIPYGESRSYADIAAAVGSPKAVRAVGQANKRNDLPIFVPCHRVIGKNSALTGYAGSKTEIKAFLLNIERISYKEK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	165 (154)
Sequences:	5998 (4493)
Seq/√Len:	362.1

ECOLI - OGT ADA
BACSU - OGT ADAB
SULSO - OGT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
135_G	141_T	3.514	1.00
60_E	66_R	3.262	1.00
83_K	108_S	3.031	1.00
153_F	157_I	2.774	1.00
87_A	90_R	2.726	1.00
97_R	105_A	2.671	1.00
100_A	136_K	2.529	1.00
19_E	74_S	2.424	1.00
77_G	85_W	2.392	1.00
97_R	101_D	2.298	1.00
8_E	13_E	2.240	1.00
152_A	156_N	2.203	1.00
75_Q	128_V	2.125	1.00
100_A	104_A	2.010	1.00
19_E	22_R	2.000	1.00
97_R	102_I	1.999	1.00
87_A	102_I	1.965	1.00
87_A	105_A	1.866	1.00
18_E	51_L	1.864	1.00
57_Q	69_F	1.823	1.00
5_T	55_K	1.803	1.00
60_E	65_E	1.793	1.00
101_D	104_A	1.711	1.00
7_A	59_Q	1.665	1.00
78_T	81_Q	1.632	1.00
16_I	23_I	1.610	1.00
88_L	119_N	1.599	1.00
26_L	127_F	1.596	1.00
77_G	81_Q	1.591	1.00
108_S	111_A	1.541	1.00
19_E	24_T	1.537	1.00
6_T	13_E	1.531	1.00
81_Q	121_R	1.524	1.00
91_I	97_R	1.511	1.00
53_E	57_Q	1.488	1.00
86_Q	89_E	1.460	1.00
112_V	116_G	1.460	1.00
97_R	133_V	1.454	1.00
53_E	56_Q	1.448	1.00
28_L	150_I	1.428	1.00
100_A	112_V	1.390	1.00
57_Q	71_L	1.383	1.00
90_R	105_A	1.374	1.00
10_P	62_F	1.365	1.00
84_V	102_I	1.354	1.00
120_K	141_T	1.349	1.00
22_R	74_S	1.349	1.00
125_P	145_G	1.346	1.00
91_I	133_V	1.346	1.00
156_N	159_R	1.342	1.00
142_G	147_K	1.291	1.00
87_A	106_V	1.267	1.00
117_Q	120_K	1.264	1.00
140_L	147_K	1.235	1.00
153_F	156_N	1.233	1.00
82_Q	86_Q	1.229	1.00
57_Q	66_R	1.216	1.00
54_A	127_F	1.202	1.00
16_I	54_A	1.189	1.00
28_L	125_P	1.181	1.00
17_A	25_R	1.159	1.00
86_Q	90_R	1.124	1.00
120_K	146_S	1.120	1.00
7_A	55_K	1.120	1.00
55_K	59_Q	1.118	1.00
9_T	14_L	1.116	1.00
21_D	74_S	1.109	1.00
149_E	152_A	1.087	1.00
117_Q	141_T	1.073	1.00
75_Q	82_Q	1.063	1.00
18_E	54_A	1.056	1.00
75_Q	123_D	1.052	1.00
30_Q	150_I	1.051	1.00
117_Q	121_R	1.049	1.00
73_L	124_L	1.048	1.00
104_A	109_P	1.044	1.00
47_E	52_A	1.032	1.00
17_A	24_T	1.024	1.00
79_P	82_Q	1.015	1.00
71_L	127_F	1.010	1.00
96_S	155_L	1.006	1.00
57_Q	70_S	0.996	1.00
89_E	128_V	0.991	1.00
119_N	143_Y	0.989	1.00
18_E	48_T	0.987	1.00
56_Q	60_E	0.984	1.00
75_Q	124_L	0.976	1.00
58_L	62_F	0.973	1.00
116_G	120_K	0.969	1.00
9_T	12_G	0.968	1.00
6_T	15_I	0.958	1.00
48_T	51_L	0.958	1.00
119_N	134_I	0.945	1.00
23_I	54_A	0.944	1.00
15_I	29_S	0.936	1.00
11_L	153_F	0.932	1.00
59_Q	63_A	0.927	1.00
13_E	29_S	0.909	1.00
50_N	72_P	0.907	1.00
141_T	147_K	0.906	1.00
61_Y	157_I	0.906	1.00
80_F	118_A	0.905	1.00
106_V	115_V	0.895	1.00
11_L	150_I	0.890	1.00
57_Q	67_K	0.890	1.00
81_Q	85_W	0.887	1.00
16_I	51_L	0.882	1.00
67_K	93_Y	0.878	1.00
102_I	119_N	0.878	1.00
80_F	114_A	0.869	1.00
156_N	160_I	0.868	1.00
50_N	53_E	0.850	1.00
135_G	139_A	0.831	1.00
5_T	52_A	0.831	1.00
135_G	142_G	0.828	1.00
14_L	26_L	0.825	1.00
150_I	153_F	0.818	1.00
81_Q	117_Q	0.818	1.00
122_N	130_C	0.817	1.00
119_N	125_P	0.814	1.00
100_A	116_G	0.814	1.00
120_K	144_A	0.810	1.00
5_T	51_L	0.801	1.00
87_A	97_R	0.796	1.00
18_E	50_N	0.790	1.00
80_F	84_V	0.789	1.00
79_P	83_K	0.789	1.00
92_P	95_E	0.780	1.00
140_L	152_A	0.772	1.00
26_L	125_P	0.772	1.00
106_V	111_A	0.760	1.00
83_K	86_Q	0.756	1.00
50_N	54_A	0.752	1.00
11_L	14_L	0.747	1.00
125_P	144_A	0.727	1.00
16_I	26_L	0.725	1.00
26_L	124_L	0.725	1.00
24_T	76_K	0.725	1.00
15_I	27_F	0.715	0.99
26_L	58_L	0.711	0.99
84_V	106_V	0.705	0.99
18_E	21_D	0.697	0.99
51_L	54_A	0.691	0.99
42_N	45_H	0.688	0.99
40_V	43_T	0.684	0.99
84_V	115_V	0.683	0.99
83_K	106_V	0.672	0.99
27_F	125_P	0.672	0.99
93_Y	157_I	0.668	0.99
41_Q	44_E	0.666	0.99
125_P	150_I	0.666	0.99
73_L	89_E	0.662	0.99
76_K	82_Q	0.661	0.99
31_E	35_D	0.659	0.99
102_I	116_G	0.657	0.99
96_S	160_I	0.655	0.99
61_Y	126_I	0.655	0.99
22_R	50_N	0.652	0.99
61_Y	69_F	0.652	0.99
135_G	140_L	0.646	0.99
14_L	28_L	0.642	0.99
7_A	16_I	0.639	0.99
91_I	119_N	0.637	0.99
111_A	114_A	0.630	0.99
97_R	119_N	0.620	0.99
57_Q	60_E	0.617	0.98
22_R	72_P	0.606	0.98
25_R	125_P	0.606	0.98
27_F	34_V	0.603	0.98
96_S	134_I	0.602	0.98
16_I	55_K	0.602	0.98
54_A	57_Q	0.602	0.98
126_I	154_L	0.602	0.98
101_D	105_A	0.598	0.98
75_Q	85_W	0.598	0.98
124_L	128_V	0.596	0.98
102_I	106_V	0.592	0.98
62_F	157_I	0.591	0.98
6_T	29_S	0.586	0.98
147_K	152_A	0.586	0.98
85_W	88_L	0.585	0.98
23_I	127_F	0.582	0.98
98_S	136_K	0.581	0.98
61_Y	93_Y	0.581	0.98
112_V	117_Q	0.578	0.98
66_R	70_S	0.574	0.98
56_Q	59_Q	0.572	0.97
124_L	127_F	0.570	0.97
58_L	127_F	0.567	0.97
126_I	157_I	0.566	0.97
88_L	102_I	0.562	0.97
58_L	126_I	0.557	0.97
33_W	121_R	0.557	0.97
141_T	144_A	0.555	0.97
66_R	93_Y	0.552	0.97
122_N	146_S	0.551	0.97
75_Q	89_E	0.550	0.97
25_R	116_G	0.545	0.97
49_P	52_A	0.542	0.97
66_R	69_F	0.542	0.97
31_E	34_V	0.540	0.96
7_A	14_L	0.539	0.96
43_T	46_K	0.535	0.96
102_I	115_V	0.534	0.96
77_G	82_Q	0.532	0.96
103_A	109_P	0.531	0.96
102_I	105_A	0.530	0.96
59_Q	62_F	0.530	0.96
98_S	135_G	0.529	0.96
58_L	61_Y	0.529	0.96
110_K	116_G	0.527	0.96
27_F	31_E	0.527	0.96
60_E	67_K	0.526	0.96
53_E	71_L	0.523	0.96
22_R	73_L	0.523	0.96
10_P	153_F	0.522	0.96
130_C	146_S	0.522	0.96
61_Y	64_G	0.518	0.96
24_T	74_S	0.517	0.95
64_G	93_Y	0.517	0.95
119_N	133_V	0.512	0.95
92_P	97_R	0.510	0.95
53_E	70_S	0.508	0.95
85_W	119_N	0.508	0.95
54_A	71_L	0.508	0.95
103_A	115_V	0.506	0.95
33_W	37_K	0.503	0.95
52_A	56_Q	0.503	0.95
78_T	113_R	0.503	0.95
23_I	124_L	0.501	0.95
119_N	144_A	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sfeA	1	0.9697	100	0.137	Contact Map
4bhbA	1	0.9697	100	0.146	Contact Map
1wrjA	1	0.903	100	0.161	Contact Map
3l00A	1	0.903	100	0.17	Contact Map
1eh6A	1	0.9394	100	0.171	Contact Map
2g7hA	1	0.9394	100	0.297	Contact Map
1mgtA	1	0.9273	100	0.301	Contact Map
2kifA	1	0.5333	100	0.403	Contact Map
3gvaA	1	0.5394	100	0.404	Contact Map
3ugoA	1	0.4061	61.9	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.