YSMA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YSMA - Uncharacterized protein YsmA

UniProt:	P11469	Sequences: MKLPAYIDMPFQEWKTSFSFFNKVSVRFSETDMFGHMNNVTPFIYFEEVRISYFKKLNMMSENKQTMTVVASQQCDYLRQVMPYEELRIYVKTSAVGSSSLTLHYLGENLEGEPCFTGAVVMVQVSKESGKAVSWTDEEKETLLHTR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (126)
Sequences:	6252 (4500)
Seq/√Len:	400.9

ECOLI - YBGC FADM
BACSU - YSMA YNEP
HALSA - Q9HPZ1
SULSO - Q97WD2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_S	76_D	3.314	1.00
94_S	104_H	2.548	1.00
81_V	115_C	2.340	1.00
46_F	118_G	2.326	1.00
79_R	113_E	2.296	1.00
78_L	117_T	2.252	1.00
126_S	129_S	2.187	1.00
74_Q	119_A	2.177	1.00
21_F	88_R	2.151	1.00
21_F	90_Y	2.113	1.00
81_V	87_L	2.112	1.00
46_F	116_F	1.977	1.00
41_T	44_I	1.955	1.00
23_K	86_E	1.943	1.00
43_F	73_Q	1.933	1.00
90_Y	106_L	1.859	1.00
95_A	102_T	1.824	1.00
43_F	75_C	1.799	1.00
90_Y	108_E	1.778	1.00
23_K	88_R	1.715	1.00
92_K	104_H	1.709	1.00
108_E	114_P	1.700	1.00
67_M	127_K	1.647	1.00
137_D	141_E	1.643	1.00
85_E	109_N	1.628	1.00
106_L	114_P	1.617	1.00
76_D	117_T	1.574	1.00
37_M	45_Y	1.552	1.00
46_F	107_G	1.549	1.00
75_C	116_F	1.519	1.00
99_S	132_A	1.514	1.00
102_T	119_A	1.505	1.00
105_Y	120_V	1.484	1.00
80_Q	130_G	1.478	1.00
25_S	86_E	1.476	1.00
89_I	107_G	1.462	1.00
104_H	119_A	1.416	1.00
94_S	119_A	1.392	1.00
136_T	139_E	1.374	1.00
97_G	100_S	1.373	1.00
106_L	117_T	1.359	1.00
52_S	56_K	1.354	1.00
140_K	144_L	1.342	1.00
25_S	55_K	1.306	1.00
49_V	91_V	1.302	1.00
29_S	44_I	1.285	1.00
100_S	121_V	1.270	1.00
40_V	44_I	1.219	1.00
25_S	52_S	1.209	1.00
49_V	89_I	1.194	1.00
98_S	134_S	1.184	1.00
125_V	130_G	1.175	1.00
23_K	110_L	1.167	1.00
71_A	76_D	1.145	1.00
26_V	37_M	1.141	1.00
86_E	110_L	1.139	1.00
47_E	50_R	1.129	1.00
55_K	84_Y	1.122	1.00
27_R	30_E	1.116	1.00
30_E	44_I	1.110	1.00
126_S	133_V	1.102	1.00
108_E	112_G	1.100	1.00
73_Q	120_V	1.086	1.00
99_S	123_V	1.083	1.00
72_S	121_V	1.066	1.00
109_N	113_E	1.060	1.00
102_T	121_V	1.034	1.00
39_N	73_Q	1.018	1.00
69_V	125_V	1.015	1.00
92_K	106_L	1.012	1.00
114_P	117_T	0.999	1.00
24_V	89_I	0.991	1.00
20_F	91_V	0.988	1.00
78_L	114_P	0.987	1.00
109_N	115_C	0.981	1.00
88_R	110_L	0.975	1.00
94_S	102_T	0.946	1.00
141_E	144_L	0.937	1.00
26_V	45_Y	0.921	1.00
71_A	121_V	0.919	1.00
22_N	52_S	0.892	1.00
72_S	119_A	0.887	1.00
104_H	117_T	0.885	1.00
45_Y	87_L	0.876	1.00
66_T	124_Q	0.875	1.00
20_F	56_K	0.857	1.00
46_F	75_C	0.856	1.00
91_V	105_Y	0.856	1.00
87_L	115_C	0.853	1.00
65_Q	128_E	0.847	1.00
34_F	69_V	0.832	1.00
27_R	48_E	0.827	1.00
30_E	45_Y	0.825	1.00
39_N	77_Y	0.819	1.00
138_E	141_E	0.810	1.00
96_V	140_K	0.791	1.00
50_R	70_V	0.779	1.00
93_T	103_L	0.776	1.00
99_S	134_S	0.775	1.00
24_V	45_Y	0.772	1.00
27_R	44_I	0.767	1.00
24_V	48_E	0.761	1.00
137_D	140_K	0.760	1.00
28_F	33_M	0.759	1.00
34_F	38_N	0.755	1.00
19_S	90_Y	0.749	1.00
28_F	31_T	0.748	1.00
22_N	48_E	0.746	1.00
50_R	105_Y	0.736	1.00
38_N	47_E	0.733	1.00
89_I	105_Y	0.731	1.00
71_A	123_V	0.731	1.00
109_N	112_G	0.729	1.00
91_V	103_L	0.728	1.00
44_I	47_E	0.726	1.00
52_S	55_K	0.726	1.00
39_N	43_F	0.701	1.00
73_Q	118_G	0.698	1.00
71_A	78_L	0.697	1.00
22_N	49_V	0.688	1.00
25_S	84_Y	0.684	1.00
137_D	144_L	0.683	0.99
107_G	116_F	0.671	0.99
39_N	50_R	0.665	0.99
138_E	142_T	0.660	0.99
101_L	135_W	0.658	0.99
41_T	45_Y	0.657	0.99
135_W	140_K	0.646	0.99
88_R	112_G	0.638	0.99
53_Y	91_V	0.636	0.99
62_E	84_Y	0.630	0.99
37_M	81_V	0.629	0.99
36_H	80_Q	0.628	0.99
53_Y	93_T	0.624	0.99
70_V	120_V	0.622	0.99
88_R	108_E	0.622	0.99
24_V	27_R	0.621	0.99
64_K	138_E	0.621	0.99
46_F	105_Y	0.613	0.99
50_R	122_M	0.612	0.99
110_L	113_E	0.607	0.99
82_M	130_G	0.605	0.99
55_K	60_M	0.604	0.99
29_S	38_N	0.602	0.99
36_H	130_G	0.598	0.99
75_C	118_G	0.598	0.99
31_T	35_G	0.596	0.99
34_F	39_N	0.593	0.99
28_F	83_P	0.591	0.99
38_N	41_T	0.591	0.99
71_A	100_S	0.585	0.98
85_E	110_L	0.581	0.98
76_D	119_A	0.579	0.98
124_Q	135_W	0.575	0.98
36_H	69_V	0.571	0.98
29_S	40_V	0.570	0.98
105_Y	122_M	0.570	0.98
69_V	127_K	0.567	0.98
42_P	81_V	0.567	0.98
71_A	99_S	0.567	0.98
73_Q	77_Y	0.564	0.98
42_P	116_F	0.562	0.98
28_F	34_F	0.560	0.98
31_T	83_P	0.559	0.98
81_V	116_F	0.559	0.98
103_L	122_M	0.559	0.98
48_E	52_S	0.555	0.98
127_K	130_G	0.543	0.97
50_R	120_V	0.535	0.97
133_V	139_E	0.535	0.97
96_V	101_L	0.534	0.97
53_Y	57_L	0.534	0.97
98_S	140_K	0.533	0.97
28_F	51_I	0.533	0.97
97_G	140_K	0.532	0.97
68_T	124_Q	0.529	0.97
29_S	48_E	0.529	0.97
85_E	115_C	0.525	0.97
34_F	67_M	0.523	0.97
19_S	92_K	0.521	0.97
31_T	41_T	0.519	0.97
43_F	77_Y	0.518	0.97
70_V	122_M	0.517	0.97
49_V	105_Y	0.508	0.96
124_Q	133_V	0.507	0.96
134_S	137_D	0.506	0.96
100_S	140_K	0.503	0.96
30_E	41_T	0.501	0.96
100_S	123_V	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2essA	2	0.8912	100	0.291	Contact Map
2ownA	3	0.9252	100	0.303	Contact Map
3qy3A	4	0.8707	99.9	0.315	Contact Map
3ck1A	4	0.9048	99.9	0.317	Contact Map
2hx5A	4	0.9048	99.9	0.317	Contact Map
2xemA	4	0.9184	99.9	0.318	Contact Map
2hljA	2	0.8844	99.9	0.319	Contact Map
2o5uA	4	0.9592	99.9	0.32	Contact Map
4k00A	4	0.8844	99.9	0.324	Contact Map
2w3xA	4	0.9116	99.9	0.324	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.