DYR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DYR - Dihydrofolate reductase

UniProt:	P11045	Sequences: MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKITSGHSIIMGRKTFESIGRPLPNRKNIVVTSAPDSEFQGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEFEGDRHFPEFDESNWKLVSSEQGTKDEKNPYDYEFLMYEKKNSSKAGGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	168 (157)
Sequences:	4698 (3566)
Seq/√Len:	284.6

ECOLI - DYR
BACSU - DYR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_L	122_G	3.308	1.00
58_K	74_T	3.080	1.00
36_S	56_N	2.897	1.00
10_A	117_H	2.890	1.00
30_Y	34_I	2.296	1.00
136_L	139_S	2.226	1.00
4_F	108_A	2.220	1.00
8_M	12_R	2.130	1.00
136_L	155_L	2.123	1.00
79_L	104_L	2.118	1.00
76_V	85_I	2.024	1.00
38_H	93_F	2.012	1.00
115_K	155_L	2.011	1.00
9_D	13_L	2.009	1.00
3_S	112_Y	2.009	1.00
78_S	81_D	1.913	1.00
111_L	129_F	1.867	1.00
40_I	59_N	1.852	1.00
31_F	95_I	1.816	1.00
64_S	99_Q	1.702	1.00
41_I	92_C	1.695	1.00
110_R	158_E	1.690	1.00
16_K	121_E	1.669	1.00
99_Q	102_T	1.661	1.00
117_H	153_E	1.661	1.00
139_S	153_E	1.639	1.00
137_V	158_E	1.638	1.00
13_L	125_H	1.620	1.00
6_F	113_M	1.606	1.00
10_A	119_E	1.594	1.00
77_S	81_D	1.584	1.00
44_R	48_E	1.573	1.00
130_D	133_N	1.571	1.00
26_N	152_Y	1.543	1.00
62_V	100_L	1.528	1.00
141_Q	153_E	1.524	1.00
144_K	151_D	1.510	1.00
30_Y	112_Y	1.504	1.00
30_Y	156_M	1.501	1.00
48_E	68_S	1.490	1.00
29_A	33_K	1.482	1.00
110_R	156_M	1.477	1.00
99_Q	103_D	1.470	1.00
3_S	91_E	1.457	1.00
9_D	120_F	1.451	1.00
38_H	91_E	1.443	1.00
94_V	104_L	1.440	1.00
98_A	102_T	1.436	1.00
39_S	58_K	1.429	1.00
5_I	93_F	1.393	1.00
70_F	73_C	1.369	1.00
8_M	115_K	1.354	1.00
60_I	76_V	1.306	1.00
34_I	112_Y	1.294	1.00
40_I	95_I	1.290	1.00
47_F	73_C	1.273	1.00
53_P	59_N	1.252	1.00
25_P	29_A	1.239	1.00
145_D	148_N	1.203	1.00
20_L	28_L	1.196	1.00
11_N	119_E	1.195	1.00
139_S	155_L	1.185	1.00
112_Y	156_M	1.181	1.00
8_M	113_M	1.179	1.00
32_K	36_S	1.178	1.00
3_S	110_R	1.166	1.00
65_A	68_S	1.153	1.00
80_K	107_Y	1.150	1.00
74_T	85_I	1.149	1.00
59_N	95_I	1.141	1.00
30_Y	154_F	1.138	1.00
117_H	151_D	1.125	1.00
50_I	59_N	1.108	1.00
136_L	157_Y	1.106	1.00
135_K	158_E	1.103	1.00
62_V	104_L	1.102	1.00
138_S	156_M	1.093	1.00
8_M	111_L	1.077	1.00
98_A	124_R	1.062	1.00
6_F	126_F	1.060	1.00
63_T	75_V	1.054	1.00
82_V	86_C	1.043	1.00
26_N	148_N	1.036	1.00
91_E	110_R	1.034	1.00
4_F	104_L	1.032	1.00
86_C	92_C	1.029	1.00
41_I	82_V	1.025	1.00
81_D	84_D	1.024	1.00
3_S	93_F	1.015	1.00
35_T	57_R	1.000	1.00
66_P	77_S	1.000	1.00
142_G	152_Y	0.999	1.00
39_S	89_P	0.998	1.00
26_N	145_D	0.973	1.00
23_H	28_L	0.972	1.00
32_K	55_P	0.971	1.00
5_I	34_I	0.962	1.00
54_L	57_R	0.957	1.00
63_T	77_S	0.957	1.00
4_F	126_F	0.935	1.00
79_L	103_D	0.931	1.00
113_M	157_Y	0.925	1.00
115_K	157_Y	0.913	1.00
45_K	48_E	0.908	1.00
12_R	128_E	0.906	1.00
63_T	68_S	0.889	1.00
84_D	87_S	0.889	1.00
60_I	86_C	0.884	1.00
46_T	49_S	0.884	1.00
42_M	50_I	0.881	1.00
6_F	14_I	0.870	1.00
82_V	104_L	0.854	1.00
18_N	49_S	0.852	1.00
6_F	111_L	0.845	1.00
4_F	101_Y	0.844	1.00
25_P	147_K	0.839	1.00
45_K	99_Q	0.837	1.00
37_G	56_N	0.833	1.00
68_S	75_V	0.832	1.00
24_L	116_I	0.830	1.00
47_F	53_P	0.828	1.00
39_S	60_I	0.828	1.00
118_H	150_Y	0.825	1.00
47_F	70_F	0.819	1.00
76_V	82_V	0.818	1.00
12_R	115_K	0.817	1.00
27_D	154_F	0.811	0.99
94_V	100_L	0.798	0.99
120_F	150_Y	0.798	0.99
9_D	119_E	0.795	0.99
83_L	107_Y	0.793	0.99
61_V	73_C	0.792	0.99
18_N	45_K	0.775	0.99
8_M	126_F	0.767	0.99
26_N	147_K	0.758	0.99
145_D	150_Y	0.752	0.99
47_F	50_I	0.745	0.99
50_I	53_P	0.739	0.99
10_A	118_H	0.738	0.99
2_I	92_C	0.727	0.99
9_D	122_G	0.727	0.99
70_F	75_V	0.726	0.99
34_I	93_F	0.723	0.99
39_S	59_N	0.718	0.99
22_W	116_I	0.715	0.99
9_D	118_H	0.714	0.99
115_K	131_E	0.711	0.99
28_L	32_K	0.707	0.99
144_K	149_P	0.697	0.98
41_I	60_I	0.697	0.98
53_P	72_G	0.693	0.98
51_G	59_N	0.692	0.98
21_P	120_F	0.685	0.98
100_L	103_D	0.679	0.98
38_H	90_E	0.679	0.98
53_P	70_F	0.677	0.98
145_D	149_P	0.669	0.98
8_M	129_F	0.664	0.98
25_P	149_P	0.657	0.98
133_N	159_K	0.648	0.98
79_L	107_Y	0.648	0.98
63_T	66_P	0.647	0.97
10_A	115_K	0.643	0.97
116_I	120_F	0.640	0.97
111_L	126_F	0.639	0.97
20_L	23_H	0.636	0.97
21_P	122_G	0.633	0.97
115_K	153_E	0.632	0.97
149_P	152_Y	0.629	0.97
21_P	101_Y	0.629	0.97
24_L	148_N	0.628	0.97
53_P	61_V	0.627	0.97
61_V	70_F	0.620	0.97
16_K	20_L	0.619	0.97
58_K	85_I	0.609	0.96
144_K	152_Y	0.608	0.96
130_D	134_W	0.607	0.96
102_T	127_P	0.599	0.96
62_V	82_V	0.596	0.96
2_I	108_A	0.595	0.96
137_V	156_M	0.589	0.96
18_N	124_R	0.589	0.96
30_Y	138_S	0.584	0.95
13_L	21_P	0.582	0.95
93_F	112_Y	0.579	0.95
4_F	105_F	0.578	0.95
62_V	103_D	0.577	0.95
42_M	46_T	0.576	0.95
18_N	123_D	0.574	0.95
53_P	73_C	0.574	0.95
133_N	136_L	0.566	0.95
80_K	84_D	0.564	0.95
142_G	151_D	0.564	0.95
6_F	127_P	0.562	0.94
129_F	157_Y	0.561	0.94
105_F	129_F	0.560	0.94
76_V	81_D	0.559	0.94
41_I	104_L	0.557	0.94
27_D	30_Y	0.555	0.94
22_W	120_F	0.551	0.94
142_G	148_N	0.551	0.94
8_M	21_P	0.550	0.94
26_N	142_G	0.546	0.94
95_I	101_Y	0.546	0.94
12_R	129_F	0.545	0.93
112_Y	154_F	0.545	0.93
146_E	151_D	0.541	0.93
144_K	150_Y	0.541	0.93
7_A	22_W	0.538	0.93
101_Y	126_F	0.537	0.93
142_G	153_E	0.536	0.93
42_M	95_I	0.534	0.93
101_Y	124_R	0.533	0.93
39_S	86_C	0.532	0.93
147_K	150_Y	0.531	0.93
104_L	107_Y	0.526	0.92
141_Q	151_D	0.524	0.92
136_L	153_E	0.523	0.92
47_F	51_G	0.523	0.92
24_L	145_D	0.522	0.92
35_T	54_L	0.521	0.92
26_N	29_A	0.519	0.92
32_K	46_T	0.519	0.92
14_I	122_G	0.515	0.91
19_D	23_H	0.514	0.91
148_N	151_D	0.510	0.91
122_G	125_H	0.505	0.91
83_L	86_C	0.504	0.91
20_L	116_I	0.503	0.90
144_K	148_N	0.503	0.90
65_A	77_S	0.502	0.90
28_L	49_S	0.502	0.90
36_S	40_I	0.501	0.90
20_L	49_S	0.501	0.90
38_H	89_P	0.500	0.90
60_I	85_I	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4eilA	3	0.9464	100	0.283	Contact Map
3ia4A	1	0.9524	100	0.284	Contact Map
2bl9A	1	0.9405	100	0.288	Contact Map
1j3kA	1	0.9524	100	0.295	Contact Map
3irmA	4	0.994	100	0.296	Contact Map
3tq8A	1	0.9881	100	0.298	Contact Map
3rg9A	1	0.9583	100	0.302	Contact Map
2w9hA	1	0.9345	100	0.302	Contact Map
1zdrA	1	0.9524	100	0.304	Contact Map
4pssA	1	0.6726	100	0.312	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.