SP2AA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP2AA - Anti-sigma F factor antagonist

UniProt:	P10727	Sequences: MSLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	117 (105)
Sequences:	2541 (1977)
Seq/√Len:	192.9

BACSU - SP2AA RSBV

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_S	108_Q	3.130	1.00
19_T	52_D	2.495	1.00
81_C	106_E	2.410	1.00
92_D	97_F	2.396	1.00
51_E	82_A	2.305	1.00
71_I	76_G	2.230	1.00
50_L	53_L	2.178	1.00
49_N	106_E	2.155	1.00
104_Q	108_Q	2.062	1.00
61_L	94_S	2.044	1.00
64_I	100_I	1.998	1.00
22_L	53_L	1.993	1.00
88_K	92_D	1.963	1.00
8_N	17_R	1.960	1.00
83_I	91_F	1.899	1.00
48_L	64_I	1.879	1.00
31_K	57_D	1.843	1.00
77_E	101_R	1.843	1.00
45_H	77_E	1.802	1.00
34_V	67_R	1.711	1.00
35_T	70_Q	1.704	1.00
79_V	103_E	1.682	1.00
62_G	66_G	1.676	1.00
33_K	36_Q	1.597	1.00
62_G	65_L	1.570	1.00
18_L	30_L	1.476	1.00
31_K	62_G	1.448	1.00
9_V	43_I	1.427	1.00
27_A	63_V	1.362	1.00
47_V	109_A	1.354	1.00
79_V	101_R	1.352	1.00
12_S	45_H	1.349	1.00
68_Y	100_I	1.305	1.00
23_D	26_T	1.282	1.00
47_V	81_C	1.282	1.00
39_E	70_Q	1.279	1.00
21_E	89_R	1.274	1.00
35_T	39_E	1.246	1.00
31_K	66_G	1.232	1.00
41_D	44_R	1.193	1.00
23_D	95_G	1.179	1.00
17_R	49_N	1.173	1.00
80_V	100_I	1.158	1.00
9_V	12_S	1.137	1.00
45_H	76_G	1.126	1.00
17_R	52_D	1.125	1.00
90_L	94_S	1.116	1.00
36_Q	40_K	1.099	1.00
24_H	57_D	1.082	1.00
57_D	62_G	1.062	1.00
88_K	104_Q	1.060	1.00
24_H	61_L	1.017	1.00
88_K	97_F	1.015	1.00
6_D	17_R	0.994	1.00
49_N	82_A	0.976	0.99
41_D	76_G	0.971	0.99
96_L	100_I	0.967	0.99
56_M	62_G	0.962	0.99
30_L	63_V	0.961	0.99
57_D	90_L	0.947	0.99
61_L	90_L	0.936	0.99
65_L	68_Y	0.936	0.99
24_H	56_M	0.926	0.99
32_Q	36_Q	0.924	0.99
34_V	48_L	0.917	0.99
47_V	110_L	0.916	0.99
68_Y	72_K	0.915	0.99
56_M	90_L	0.902	0.99
107_Q	111_L	0.895	0.99
55_F	96_L	0.887	0.99
62_G	96_L	0.883	0.99
83_I	102_F	0.881	0.99
35_T	67_R	0.872	0.99
65_L	96_L	0.838	0.98
38_L	41_D	0.837	0.98
13_V	47_V	0.831	0.98
106_E	110_L	0.830	0.98
22_L	30_L	0.824	0.98
21_E	54_S	0.821	0.98
83_I	88_K	0.819	0.98
103_E	108_Q	0.819	0.98
23_D	55_F	0.818	0.98
17_R	106_E	0.813	0.98
56_M	87_V	0.813	0.98
21_E	95_G	0.812	0.98
62_G	95_G	0.794	0.98
29_T	32_Q	0.794	0.98
62_G	69_K	0.763	0.97
47_V	79_V	0.759	0.97
10_K	107_Q	0.747	0.96
37_S	40_K	0.734	0.96
26_T	60_G	0.731	0.96
22_L	56_M	0.716	0.96
80_V	83_I	0.713	0.95
24_H	91_F	0.713	0.95
57_D	96_L	0.711	0.95
16_I	53_L	0.709	0.95
57_D	93_M	0.705	0.95
80_V	91_F	0.703	0.95
91_F	100_I	0.702	0.95
103_E	109_A	0.701	0.95
16_I	34_V	0.692	0.95
7_M	33_K	0.689	0.95
48_L	67_R	0.676	0.94
17_R	51_E	0.676	0.94
13_V	110_L	0.674	0.94
63_V	66_G	0.669	0.94
48_L	78_M	0.661	0.93
51_E	83_I	0.660	0.93
72_K	77_E	0.657	0.93
89_R	95_G	0.653	0.93
88_K	102_F	0.652	0.93
21_E	57_D	0.636	0.92
28_E	32_Q	0.629	0.91
20_G	53_L	0.622	0.91
20_G	95_G	0.615	0.90
90_L	96_L	0.614	0.90
84_S	87_V	0.612	0.90
38_L	70_Q	0.608	0.90
108_Q	111_L	0.605	0.90
65_L	69_K	0.598	0.89
44_R	76_G	0.598	0.89
68_Y	96_L	0.597	0.89
24_H	95_G	0.597	0.89
69_K	96_L	0.596	0.89
59_S	96_L	0.595	0.89
63_V	67_R	0.588	0.88
41_D	74_I	0.576	0.87
46_I	67_R	0.569	0.87
30_L	53_L	0.567	0.87
79_V	109_A	0.567	0.87
52_D	111_L	0.567	0.87
16_I	67_R	0.566	0.86
57_D	60_G	0.565	0.86
23_D	89_R	0.563	0.86
62_G	90_L	0.561	0.86
14_L	46_I	0.553	0.85
9_V	15_C	0.539	0.84
46_I	78_M	0.536	0.83
94_S	97_F	0.535	0.83
50_L	78_M	0.533	0.83
64_I	94_S	0.532	0.83
55_F	67_R	0.530	0.83
35_T	66_G	0.530	0.83
97_F	102_F	0.529	0.83
36_Q	39_E	0.527	0.82
44_R	75_G	0.526	0.82
107_Q	110_L	0.526	0.82
86_A	93_M	0.525	0.82
50_L	87_V	0.523	0.82
50_L	64_I	0.523	0.82
25_H	28_E	0.523	0.82
12_S	43_I	0.522	0.82
54_S	84_S	0.519	0.81
68_Y	94_S	0.511	0.80
15_C	47_V	0.506	0.80
7_M	37_S	0.506	0.80
30_L	93_M	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xs5A	1	0.9573	99.9	0.317	Contact Map
3zxnA	1	0.9829	99.9	0.32	Contact Map
1th8B	1	0.9829	99.9	0.323	Contact Map
4qtpA	2	0.9658	99.9	0.339	Contact Map
1sboA	1	0.9231	99.9	0.344	Contact Map
1h4xA	1	0.9487	99.9	0.354	Contact Map
3t6oA	5	0.9829	99.9	0.355	Contact Map
2ka5A	1	0.9829	99.9	0.364	Contact Map
4hylA	2	0.9573	99.9	0.366	Contact Map
3ny7A	1	0.9402	99.8	0.375	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.