GPSB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GPSB - Cell cycle protein GpsB

UniProt:	P0CI74	Sequences: MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKKQLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (92)
Sequences:	307 (195)
Seq/√Len:	20.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_L	65_A	4.378	1.00
21_G	26_K	3.732	1.00
80_I	84_L	3.588	1.00
8_L	36_M	3.087	0.99
55_N	58_L	2.797	0.99
5_K	12_E	2.764	0.99
9_S	12_E	2.069	0.93
61_Q	64_E	2.017	0.92
90_H	96_L	1.960	0.90
7_K	36_M	1.957	0.90
74_N	78_F	1.922	0.89
49_E	53_Q	1.889	0.89
33_F	45_H	1.805	0.86
6_V	43_T	1.805	0.86
21_G	89_K	1.804	0.86
47_E	52_Q	1.628	0.80
9_S	29_D	1.614	0.79
86_N	92_F	1.572	0.77
64_E	90_H	1.555	0.76
52_Q	55_N	1.483	0.73
19_K	89_K	1.469	0.72
90_H	94_S	1.468	0.72
81_L	85_S	1.460	0.72
47_E	50_E	1.456	0.71
51_L	55_N	1.425	0.70
63_E	67_K	1.322	0.64
64_E	68_K	1.257	0.60
10_A	49_E	1.227	0.58
76_T	80_I	1.222	0.58
23_R	93_G	1.206	0.57
45_H	55_N	1.205	0.57
26_K	68_K	1.200	0.56
54_E	59_K	1.180	0.55
56_L	72_Q	1.179	0.55
61_Q	68_K	1.171	0.54
11_K	42_E	1.135	0.52
11_K	54_E	1.126	0.51
15_E	33_F	1.125	0.51
19_K	77_N	1.087	0.49
86_N	96_L	1.087	0.49
11_K	15_E	1.050	0.46
55_N	59_K	1.029	0.45
10_A	45_H	1.007	0.44
17_E	39_K	1.001	0.43
19_K	93_G	0.985	0.42
10_A	46_Q	0.973	0.41
39_K	43_T	0.970	0.41
74_N	96_L	0.933	0.39
60_K	70_P	0.930	0.39
63_E	82_K	0.916	0.38
76_T	96_L	0.915	0.38
75_T	95_K	0.895	0.37
48_I	51_L	0.891	0.36
20_T	62_L	0.875	0.35
19_K	79_D	0.863	0.35
14_L	94_S	0.859	0.34
9_S	93_G	0.832	0.33
26_K	89_K	0.821	0.32
57_Q	72_Q	0.819	0.32
9_S	94_S	0.815	0.32
6_V	44_F	0.815	0.32
50_E	54_E	0.803	0.31
8_L	16_K	0.799	0.31
28_E	49_E	0.796	0.31
9_S	59_K	0.793	0.31
64_E	70_P	0.783	0.30
86_N	93_G	0.776	0.30
15_E	49_E	0.770	0.29
14_L	95_K	0.766	0.29
9_S	73_S	0.750	0.28
26_K	95_K	0.749	0.28
21_G	27_Q	0.748	0.28
46_Q	49_E	0.744	0.28
61_Q	65_A	0.742	0.28
81_L	92_F	0.741	0.28
68_K	75_T	0.736	0.28
29_D	32_K	0.733	0.27
48_I	73_S	0.728	0.27
57_Q	92_F	0.721	0.27
17_E	23_R	0.713	0.26
22_V	84_L	0.712	0.26
66_S	70_P	0.700	0.26
62_L	67_K	0.691	0.25
63_E	71_V	0.687	0.25
46_Q	50_E	0.684	0.25
16_K	85_S	0.677	0.25
45_H	53_Q	0.672	0.24
53_Q	64_E	0.668	0.24
19_K	29_D	0.658	0.24
38_I	51_L	0.645	0.23
21_G	47_E	0.635	0.23
9_S	25_Y	0.628	0.22
11_K	71_V	0.627	0.22
92_F	95_K	0.625	0.22
22_V	26_K	0.624	0.22
28_E	82_K	0.614	0.22
28_E	32_K	0.609	0.21
64_E	72_Q	0.607	0.21
23_R	54_E	0.605	0.21
14_L	25_Y	0.603	0.21
12_E	42_E	0.599	0.21
9_S	64_E	0.594	0.21
19_K	76_T	0.593	0.21
60_K	67_K	0.592	0.21
23_R	39_K	0.588	0.21
73_S	82_K	0.586	0.20
23_R	29_D	0.579	0.20
39_K	46_Q	0.579	0.20
43_T	49_E	0.574	0.20
79_D	84_L	0.574	0.20
32_K	82_K	0.569	0.20
10_A	95_K	0.568	0.20
46_Q	53_Q	0.568	0.20
14_L	96_L	0.568	0.20
67_K	82_K	0.568	0.20
63_E	68_K	0.565	0.20
13_I	58_L	0.562	0.19
68_K	72_Q	0.561	0.19
16_K	27_Q	0.558	0.19
49_E	72_Q	0.552	0.19
29_D	73_S	0.551	0.19
39_K	75_T	0.550	0.19
56_L	59_K	0.549	0.19
9_S	60_K	0.547	0.19
57_Q	82_K	0.546	0.19
59_K	63_E	0.542	0.19
57_Q	63_E	0.538	0.18
64_E	67_K	0.532	0.18
23_R	27_Q	0.531	0.18
45_H	49_E	0.528	0.18
21_G	75_T	0.525	0.18
80_I	92_F	0.522	0.18
32_K	90_H	0.517	0.18
15_E	80_I	0.512	0.17
54_E	93_G	0.509	0.17
22_V	42_E	0.507	0.17
54_E	58_L	0.507	0.17
51_L	86_N	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wujA	2	0.5102	99.5	0.608	Contact Map
3swyA	3	0.4694	57.5	0.903	Contact Map
4y66B	1	0.9388	53.1	0.905	Contact Map
3q4fC	2	0.6224	36	0.915	Contact Map
4dznA	3	0.3265	35.8	0.915	Contact Map
3swfA	3	0.551	31.7	0.917	Contact Map
4wbdA	2	0.898	30.3	0.918	Contact Map
3wpaA	3	0	26.3	0.92	Contact Map
1sesA	2	0.949	24.7	0.921	Contact Map
3ucsA	2	0.6224	24.5	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.