PTHP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTHP - Phosphocarrier protein HPr

UniProt:	P08877	Sequences: MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	88 (82)
Sequences:	2910 (1940)
Seq/√Len:	214.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_T	60_E	2.918	1.00
65_A	74_L	2.765	1.00
30_D	68_A	2.463	1.00
3_Q	62_T	2.291	1.00
6_F	78_E	2.279	1.00
4_K	78_E	2.229	1.00
31_A	69_D	2.071	1.00
34_N	41_T	2.066	1.00
29_Y	76_A	2.026	1.00
41_T	64_S	2.022	1.00
25_T	28_K	2.018	1.00
36_E	62_T	2.012	1.00
36_E	64_S	2.000	1.00
36_E	41_T	1.967	1.00
5_T	62_T	1.903	1.00
78_E	82_K	1.834	1.00
71_N	75_N	1.772	1.00
9_T	85_G	1.737	1.00
37_Y	59_A	1.712	1.00
3_Q	64_S	1.687	1.00
7_K	60_E	1.630	1.00
30_D	69_D	1.629	1.00
79_E	84_E	1.601	1.00
22_L	44_L	1.427	1.00
9_T	82_K	1.366	1.00
25_T	76_A	1.353	1.00
32_D	66_S	1.329	1.00
26_A	77_L	1.315	1.00
75_N	79_E	1.285	1.00
22_L	77_L	1.284	1.00
72_D	76_A	1.261	1.00
4_K	75_N	1.145	1.00
32_D	43_N	1.107	1.00
29_Y	73_A	1.097	1.00
22_L	81_M	1.095	1.00
55_I	61_I	1.084	1.00
11_D	57_K	1.083	1.00
56_A	59_A	1.080	1.00
42_V	53_L	1.067	1.00
33_V	73_A	1.056	1.00
36_E	39_G	1.053	1.00
72_D	75_N	1.018	1.00
14_I	22_L	1.014	1.00
31_A	65_A	1.000	1.00
22_L	35_L	0.976	1.00
8_V	55_I	0.965	1.00
69_D	72_D	0.958	1.00
43_N	46_S	0.922	0.99
21_V	24_Q	0.871	0.99
33_V	65_A	0.856	0.99
6_F	63_I	0.844	0.99
26_A	33_V	0.822	0.99
4_K	82_K	0.801	0.98
33_V	44_L	0.791	0.98
20_T	51_M	0.788	0.98
21_V	25_T	0.787	0.98
46_S	49_G	0.786	0.98
12_S	18_P	0.774	0.98
42_V	48_M	0.768	0.98
76_A	79_E	0.763	0.98
10_A	80_T	0.738	0.97
16_A	20_T	0.735	0.97
63_I	81_M	0.730	0.97
26_A	73_A	0.726	0.97
34_N	64_S	0.725	0.97
25_T	80_T	0.724	0.97
24_Q	28_K	0.720	0.97
48_M	52_S	0.718	0.97
61_I	81_M	0.715	0.97
23_V	47_I	0.699	0.96
19_A	50_V	0.699	0.96
26_A	45_K	0.699	0.96
27_S	49_G	0.690	0.96
37_Y	55_I	0.690	0.96
29_Y	69_D	0.689	0.96
63_I	77_L	0.685	0.96
21_V	80_T	0.679	0.96
48_M	51_M	0.673	0.95
4_K	74_L	0.672	0.95
18_P	21_V	0.662	0.95
22_L	63_I	0.659	0.95
43_N	48_M	0.655	0.95
20_T	24_Q	0.653	0.95
63_I	74_L	0.651	0.94
34_N	43_N	0.649	0.94
74_L	78_E	0.646	0.94
6_F	81_M	0.644	0.94
42_V	49_G	0.641	0.94
15_H	80_T	0.621	0.93
8_V	81_M	0.613	0.92
31_A	70_E	0.613	0.92
27_S	47_I	0.608	0.92
54_G	59_A	0.606	0.92
38_N	59_A	0.590	0.91
13_G	19_A	0.582	0.90
19_A	49_G	0.575	0.90
16_A	47_I	0.568	0.89
20_T	52_S	0.567	0.89
78_E	81_M	0.561	0.89
16_A	48_M	0.560	0.89
47_I	51_M	0.555	0.88
32_D	45_K	0.552	0.88
23_V	50_V	0.548	0.88
6_F	14_I	0.538	0.87
69_D	73_A	0.538	0.87
36_E	42_V	0.537	0.87
16_A	49_G	0.537	0.87
47_I	54_G	0.536	0.86
14_I	55_I	0.533	0.86
10_A	14_I	0.529	0.86
19_A	47_I	0.528	0.86
6_F	74_L	0.526	0.85
16_A	54_G	0.520	0.85
20_T	46_S	0.518	0.85
35_L	63_I	0.514	0.84
43_N	49_G	0.508	0.83
7_K	57_K	0.507	0.83
35_L	50_V	0.506	0.83
25_T	29_Y	0.505	0.83
40_K	50_V	0.505	0.83
10_A	51_M	0.504	0.83
10_A	85_G	0.502	0.83
65_A	70_E	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3le1A	1	0.9886	100	0.108	Contact Map
1kklH	1	0.9773	100	0.11	Contact Map
1sphA	2	0.9773	100	0.112	Contact Map
1y51A	1	0.9773	100	0.113	Contact Map
1ptfA	1	0.9886	100	0.121	Contact Map
1pchA	1	0.9773	100	0.138	Contact Map
1ka5A	1	1	100	0.148	Contact Map
3ihsA	1	0.9318	100	0.156	Contact Map
3ccdA	2	0.9659	100	0.16	Contact Map
2jpiA	1	0.8864	73.1	0.869	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.