ABRB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ABRB - Transition state regulatory protein AbrB

UniProt:	P08874	Sequences: MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEGAEQIISEIQNQLQNLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (79)
Sequences:	836 (471)
Seq/√Len:	53.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_T	77_S	4.789	1.00
77_S	80_G	4.724	1.00
22_I	26_R	3.768	1.00
59_T	80_G	3.720	1.00
30_I	36_L	2.099	1.00
56_C	59_T	2.015	1.00
41_D	44_K	1.957	1.00
56_C	80_G	1.917	0.99
14_E	33_K	1.889	0.99
26_R	31_A	1.878	0.99
11_K	14_E	1.849	0.99
39_Y	48_K	1.785	0.99
31_A	34_D	1.719	0.99
77_S	81_A	1.553	0.98
61_E	79_E	1.468	0.97
32_E	38_I	1.461	0.97
33_K	38_I	1.361	0.95
66_N	78_K	1.355	0.95
44_K	48_K	1.319	0.94
26_R	34_D	1.306	0.94
71_G	83_Q	1.289	0.93
82_E	86_S	1.249	0.92
6_T	27_T	1.242	0.92
56_C	77_S	1.228	0.91
5_S	52_P	1.193	0.90
14_E	22_I	1.162	0.89
57_Q	70_A	1.151	0.89
9_V	45_I	1.130	0.88
58_V	70_A	1.115	0.87
57_Q	75_V	1.112	0.87
42_D	82_E	1.101	0.86
58_V	73_K	1.073	0.85
58_V	62_V	1.032	0.82
29_G	84_I	1.031	0.82
71_G	84_I	1.011	0.81
8_I	23_E	0.990	0.80
30_I	49_K	0.989	0.80
20_I	24_L	0.980	0.79
78_K	82_E	0.970	0.78
80_G	85_I	0.957	0.77
55_T	59_T	0.925	0.75
6_T	40_V	0.907	0.73
81_A	85_I	0.905	0.73
12_V	19_V	0.882	0.71
45_I	66_N	0.875	0.71
79_E	82_E	0.858	0.69
44_K	63_S	0.838	0.67
9_V	26_R	0.837	0.67
31_A	44_K	0.834	0.67
69_L	72_G	0.831	0.67
77_S	85_I	0.830	0.67
48_K	70_A	0.816	0.65
79_E	83_Q	0.813	0.65
56_C	60_G	0.805	0.64
8_I	27_T	0.786	0.62
63_S	78_K	0.775	0.61
58_V	75_V	0.771	0.61
20_I	33_K	0.770	0.61
36_L	52_P	0.765	0.60
46_I	72_G	0.764	0.60
58_V	69_L	0.761	0.60
58_V	80_G	0.761	0.60
16_G	25_R	0.756	0.59
57_Q	63_S	0.753	0.59
79_E	84_I	0.750	0.59
11_K	31_A	0.748	0.59
55_T	62_V	0.744	0.58
15_L	24_L	0.719	0.56
41_D	47_L	0.706	0.54
67_L	85_I	0.702	0.54
12_V	22_I	0.693	0.53
33_K	45_I	0.686	0.52
51_K	68_K	0.684	0.52
13_D	17_R	0.673	0.51
43_E	61_E	0.663	0.50
18_V	22_I	0.654	0.49
70_A	85_I	0.653	0.49
12_V	86_S	0.646	0.48
41_D	46_I	0.627	0.46
69_L	74_L	0.624	0.46
58_V	67_L	0.622	0.45
18_V	32_E	0.621	0.45
3_M	6_T	0.615	0.45
5_S	14_E	0.615	0.45
62_V	67_L	0.607	0.44
31_A	51_K	0.607	0.44
67_L	74_L	0.605	0.44
8_I	30_I	0.601	0.43
32_E	46_I	0.597	0.43
30_I	34_D	0.594	0.43
77_S	83_Q	0.593	0.42
28_L	40_V	0.593	0.42
5_S	45_I	0.592	0.42
35_A	50_Y	0.587	0.42
20_I	57_Q	0.587	0.42
57_Q	85_I	0.585	0.42
56_C	70_A	0.576	0.41
67_L	72_G	0.571	0.40
24_L	86_S	0.569	0.40
21_P	37_E	0.566	0.40
4_K	42_D	0.566	0.40
51_K	81_A	0.566	0.40
71_G	81_A	0.559	0.39
80_G	84_I	0.556	0.39
39_Y	69_L	0.549	0.38
7_G	23_E	0.546	0.38
28_L	45_I	0.545	0.38
28_L	35_A	0.542	0.37
27_T	32_E	0.531	0.36
51_K	55_T	0.531	0.36
61_E	71_G	0.515	0.35
4_K	24_L	0.514	0.35
15_L	83_Q	0.514	0.35
3_M	22_I	0.512	0.34
43_E	71_G	0.511	0.34
6_T	23_E	0.509	0.34
22_I	35_A	0.507	0.34
38_I	47_L	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2w1tA	2	0.9375	99.6	0.583	Contact Map
1yfbA	2	0.5417	99.4	0.631	Contact Map
2mrnA	2	0.5521	98.7	0.723	Contact Map
2l66A	2	0.5312	98.6	0.733	Contact Map
3o27A	2	0.5625	98	0.774	Contact Map
2mjgA	2	0.4792	97.7	0.789	Contact Map
1mvfD	1	0.4583	97.5	0.798	Contact Map
2glwA	1	0.5	97.4	0.799	Contact Map
1n0eA	5	0.75	76.4	0.888	Contact Map
3zvkE	2	0.5938	42.9	0.91	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.