YWJG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWJG - Uncharacterized protein YwjG

UniProt:	P06629	Sequences: MLKIFTTQLTGIFSRIQDKESDAIEDGARLLAQAVISGHSIYLYGANELQGVFYEATESKEPFPSVKAFPENAEEVTESDRVLMFCSGTGTAEEQELAKELYEKGAGVVCVSPAAKDSAGIEQYCDVHIDSKLKMPLVPDEDGTRYGFPSLMTALYVYHALSFTLKEILQEYA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (170)
Sequences:	143 (108)
Seq/√Len:	8.3

BACSU - YWJG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_F	111_V	6.332	1.00
4_I	138_V	3.565	0.95
51_G	151_L	3.120	0.90
5_F	147_G	3.042	0.89
34_A	81_R	2.980	0.88
10_T	152_M	2.508	0.77
34_A	37_S	2.487	0.76
4_I	153_T	2.430	0.75
62_P	66_V	2.292	0.70
37_S	81_R	2.285	0.70
6_T	156_Y	2.105	0.63
20_E	37_S	2.085	0.62
136_P	142_D	2.061	0.61
49_L	111_V	1.988	0.59
29_R	145_R	1.943	0.57
45_G	128_H	1.840	0.52
42_Y	76_V	1.780	0.50
162_S	166_K	1.762	0.49
29_R	139_P	1.736	0.48
113_P	131_S	1.702	0.47
49_L	85_F	1.689	0.46
52_V	154_A	1.673	0.45
40_S	67_K	1.628	0.44
5_F	14_S	1.619	0.43
1_M	42_Y	1.614	0.43
69_F	138_V	1.577	0.42
19_K	142_D	1.505	0.39
24_I	85_F	1.501	0.39
14_S	18_D	1.494	0.38
140_D	144_T	1.484	0.38
9_L	13_F	1.469	0.37
138_V	163_F	1.460	0.37
162_S	165_L	1.455	0.37
107_G	148_F	1.454	0.37
36_I	67_K	1.451	0.37
112_S	128_H	1.439	0.36
29_R	137_L	1.422	0.35
4_I	136_P	1.421	0.35
108_V	125_C	1.416	0.35
136_P	144_T	1.413	0.35
86_C	99_K	1.410	0.35
24_I	76_V	1.391	0.34
46_A	97_L	1.387	0.34
47_N	93_E	1.374	0.34
50_Q	157_V	1.373	0.34
62_P	162_S	1.363	0.33
37_S	121_I	1.360	0.33
90_G	120_G	1.341	0.32
49_L	59_S	1.322	0.32
108_V	124_Y	1.314	0.31
56_A	98_A	1.311	0.31
139_P	145_R	1.309	0.31
112_S	121_I	1.309	0.31
121_I	154_A	1.298	0.31
25_E	139_P	1.278	0.30
141_E	161_L	1.252	0.29
43_L	89_T	1.250	0.29
58_E	74_E	1.247	0.29
47_N	103_E	1.221	0.28
29_R	143_G	1.220	0.28
4_I	10_T	1.216	0.28
5_F	164_T	1.215	0.28
49_L	154_A	1.211	0.28
91_T	94_E	1.200	0.27
24_I	114_A	1.198	0.27
74_E	123_Q	1.197	0.27
12_I	138_V	1.160	0.26
49_L	141_E	1.156	0.26
2_L	6_T	1.154	0.26
2_L	160_A	1.148	0.26
13_F	167_E	1.129	0.25
13_F	152_M	1.119	0.25
59_S	87_S	1.116	0.25
24_I	111_V	1.106	0.24
26_D	147_G	1.105	0.24
25_E	29_R	1.101	0.24
10_T	61_E	1.101	0.24
5_F	163_F	1.101	0.24
94_E	97_L	1.088	0.24
37_S	167_E	1.087	0.24
110_C	124_Y	1.087	0.24
6_T	51_G	1.080	0.24
62_P	138_V	1.079	0.24
109_V	163_F	1.077	0.24
16_I	131_S	1.074	0.24
3_K	167_E	1.064	0.23
59_S	159_H	1.054	0.23
121_I	129_I	1.040	0.22
127_V	134_K	1.034	0.22
110_C	125_C	1.034	0.22
52_V	101_L	1.031	0.22
16_I	96_E	1.018	0.22
6_T	36_I	1.009	0.22
57_T	68_A	0.980	0.21
40_S	76_V	0.977	0.21
111_V	119_A	0.958	0.20
45_G	91_T	0.958	0.20
83_L	111_V	0.951	0.20
54_Y	151_L	0.941	0.20
57_T	100_E	0.933	0.20
36_I	148_F	0.928	0.19
12_I	169_L	0.924	0.19
18_D	67_K	0.922	0.19
58_E	123_Q	0.919	0.19
43_L	166_K	0.912	0.19
42_Y	85_F	0.906	0.19
26_D	145_R	0.905	0.19
26_D	55_E	0.904	0.19
110_C	121_I	0.891	0.18
27_G	159_H	0.889	0.18
51_G	107_G	0.874	0.18
92_A	170_Q	0.874	0.18
16_I	100_E	0.874	0.18
82_V	168_I	0.865	0.18
13_F	61_E	0.864	0.18
152_M	159_H	0.851	0.17
83_L	161_L	0.848	0.17
49_L	52_V	0.844	0.17
3_K	17_Q	0.843	0.17
151_L	159_H	0.843	0.17
94_E	110_C	0.841	0.17
73_A	108_V	0.833	0.17
146_Y	163_F	0.832	0.17
11_G	48_E	0.827	0.17
23_A	90_G	0.824	0.17
150_S	171_E	0.819	0.17
5_F	26_D	0.818	0.17
143_G	155_L	0.807	0.16
35_V	65_S	0.802	0.16
55_E	130_D	0.798	0.16
98_A	101_L	0.796	0.16
93_E	96_E	0.796	0.16
77_T	131_S	0.793	0.16
146_Y	167_E	0.791	0.16
55_E	147_G	0.790	0.16
5_F	55_E	0.787	0.16
74_E	167_E	0.784	0.16
87_S	125_C	0.780	0.16
32_A	127_V	0.779	0.16
51_G	54_Y	0.774	0.16
27_G	161_L	0.774	0.16
14_S	160_A	0.770	0.16
67_K	168_I	0.767	0.16
63_F	86_C	0.764	0.15
52_V	59_S	0.762	0.15
71_E	120_G	0.761	0.15
2_L	61_E	0.761	0.15
35_V	116_K	0.756	0.15
59_S	150_S	0.755	0.15
117_D	171_E	0.755	0.15
39_H	144_T	0.754	0.15
94_E	112_S	0.750	0.15
16_I	161_L	0.741	0.15
45_G	141_E	0.737	0.15
13_F	140_D	0.735	0.15
45_G	69_F	0.734	0.15
85_F	151_L	0.733	0.15
54_Y	93_E	0.729	0.15
4_I	13_F	0.727	0.15
91_T	110_C	0.726	0.15
55_E	168_I	0.720	0.15
29_R	32_A	0.718	0.15
126_D	155_L	0.697	0.14
27_G	127_V	0.696	0.14
43_L	63_F	0.695	0.14
139_P	143_G	0.695	0.14
161_L	168_I	0.695	0.14
23_A	169_L	0.692	0.14
4_I	157_V	0.691	0.14
140_D	146_Y	0.689	0.14
12_I	136_P	0.689	0.14
71_E	92_A	0.685	0.14
23_A	27_G	0.685	0.14
71_E	82_V	0.681	0.14
1_M	9_L	0.666	0.13
49_L	90_G	0.663	0.13
123_Q	153_T	0.656	0.13
38_G	93_E	0.653	0.13
78_E	110_C	0.646	0.13
52_V	68_A	0.646	0.13
76_V	89_T	0.642	0.13
131_S	148_F	0.639	0.13
12_I	113_P	0.638	0.13
98_A	108_V	0.637	0.13
78_E	115_A	0.636	0.13
28_A	166_K	0.635	0.13
22_D	108_V	0.634	0.13
72_N	96_E	0.631	0.13
63_F	159_H	0.629	0.13
108_V	153_T	0.627	0.13
14_S	144_T	0.623	0.13
4_I	19_K	0.621	0.13
128_H	147_G	0.620	0.13
49_L	87_S	0.619	0.13
16_I	41_I	0.618	0.13
125_C	138_V	0.618	0.13
56_A	154_A	0.617	0.13
50_Q	131_S	0.616	0.13
60_K	116_K	0.614	0.12
31_L	81_R	0.606	0.12
26_D	126_D	0.606	0.12
23_A	102_Y	0.603	0.12
63_F	92_A	0.602	0.12
52_V	170_Q	0.601	0.12
42_Y	120_G	0.596	0.12
71_E	117_D	0.590	0.12
130_D	133_L	0.589	0.12
2_L	48_E	0.587	0.12
50_Q	61_E	0.585	0.12
10_T	15_R	0.584	0.12
138_V	157_V	0.583	0.12
20_E	51_G	0.582	0.12
87_S	148_F	0.581	0.12
73_A	96_E	0.579	0.12
45_G	169_L	0.579	0.12
65_S	118_S	0.578	0.12
132_K	138_V	0.574	0.12
128_H	146_Y	0.574	0.12
18_D	76_V	0.573	0.12
41_I	129_I	0.568	0.12
137_L	145_R	0.565	0.12
55_E	128_H	0.561	0.12
47_N	151_L	0.557	0.11
60_K	106_A	0.557	0.11
147_G	171_E	0.555	0.11
130_D	171_E	0.548	0.11
55_E	126_D	0.547	0.11
36_I	124_Y	0.544	0.11
7_T	29_R	0.541	0.11
127_V	159_H	0.540	0.11
27_G	164_T	0.538	0.11
75_E	82_V	0.538	0.11
52_V	121_I	0.537	0.11
54_Y	71_E	0.537	0.11
3_K	15_R	0.535	0.11
76_V	92_A	0.532	0.11
121_I	125_C	0.531	0.11
67_K	169_L	0.530	0.11
47_N	104_K	0.529	0.11
2_L	168_I	0.527	0.11
56_A	157_V	0.527	0.11
132_K	163_F	0.522	0.11
61_E	162_S	0.520	0.11
157_V	171_E	0.520	0.11
42_Y	93_E	0.518	0.11
60_K	111_V	0.515	0.11
95_Q	112_S	0.511	0.11
136_P	162_S	0.510	0.11
147_G	157_V	0.508	0.11
136_P	156_Y	0.507	0.11
50_Q	78_E	0.504	0.11
45_G	112_S	0.503	0.11
99_K	116_K	0.502	0.11
20_E	118_S	0.501	0.11
30_L	139_P	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3jx9A	2	0.9653	99.9	0.677	Contact Map
3cvjA	2	1	99.5	0.784	Contact Map
2i2wA	4	0.9191	98.9	0.832	Contact Map
2yvaA	4	0.8902	98.9	0.833	Contact Map
3trjA	4	0.8902	98.8	0.838	Contact Map
1m3sA	4	0.9538	98.8	0.841	Contact Map
2xblA	4	0.9249	98.8	0.842	Contact Map
2xhzA	4	0.9306	98.7	0.844	Contact Map
1x92A	4	0.9075	98.7	0.844	Contact Map
1tk9A	4	0.8902	98.7	0.845	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.