RL34 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL34 - 50S ribosomal protein L34

UniProt:	P05647	Sequences: MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	44 (43)
Sequences:	188 (39)
Seq/√Len:	5.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_N	11_K	3.751	0.91
8_N	14_K	3.348	0.85
10_R	14_K	2.668	0.68
11_K	15_V	1.801	0.38
9_N	13_S	1.737	0.36
15_V	20_S	1.678	0.34
3_R	6_Q	1.635	0.33
5_F	12_R	1.626	0.33
36_R	41_V	1.541	0.30
8_N	15_V	1.509	0.29
15_V	43_S	1.488	0.29
5_F	9_N	1.341	0.25
26_N	30_V	1.324	0.24
25_K	29_L	1.236	0.22
13_S	41_V	1.228	0.22
29_L	36_R	1.143	0.20
23_S	33_R	1.091	0.19
11_K	20_S	1.082	0.19
12_R	19_R	1.064	0.18
31_L	40_K	1.018	0.17
30_V	33_R	0.956	0.16
6_Q	33_R	0.937	0.16
5_F	33_R	0.926	0.15
36_R	40_K	0.917	0.15
32_A	43_S	0.892	0.15
9_N	29_L	0.880	0.15
2_K	6_Q	0.858	0.14
15_V	30_V	0.857	0.14
6_Q	42_L	0.849	0.14
33_R	36_R	0.837	0.14
20_S	23_S	0.833	0.14
2_K	11_K	0.829	0.14
29_L	32_A	0.815	0.14
8_N	23_S	0.811	0.13
13_S	24_S	0.807	0.13
29_L	33_R	0.795	0.13
26_N	32_A	0.786	0.13
19_R	32_A	0.730	0.12
25_K	36_R	0.695	0.12
23_S	29_L	0.692	0.12
26_N	41_V	0.689	0.12
23_S	36_R	0.678	0.11
9_N	32_A	0.671	0.11
2_K	42_L	0.668	0.11
14_K	20_S	0.657	0.11
3_R	11_K	0.627	0.11
8_N	19_R	0.625	0.11
20_S	32_A	0.624	0.11
3_R	8_N	0.614	0.11
31_L	38_G	0.609	0.10
20_S	33_R	0.604	0.10
20_S	29_L	0.570	0.10
2_K	8_N	0.556	0.10
19_R	36_R	0.553	0.10
15_V	32_A	0.542	0.10
26_N	29_L	0.539	0.10
5_F	14_K	0.537	0.10
4_T	30_V	0.535	0.10
4_T	37_K	0.530	0.09
23_S	40_K	0.525	0.09
15_V	19_R	0.515	0.09
12_R	15_V	0.510	0.09
14_K	31_L	0.507	0.09
2_K	25_K	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4tp92	1	1	99.8	0.107	Contact Map
4rb67	1	1	99.8	0.107	Contact Map
3j3w2	1	1	99.8	0.113	Contact Map
1vw4Y	1	1	99.8	0.128	Contact Map
3j7y2	1	0.9773	99.7	0.135	Contact Map
3bbo4	1	0.7727	99.6	0.208	Contact Map
4ujqD	1	0.3864	2.2	0.912	Contact Map
2k3yA	1	0.4091	2.1	0.913	Contact Map
2jpjA	1	0.3636	1.8	0.916	Contact Map
3ed3A	1	0.2045	1.6	0.918	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.