RS11 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS11 - 30S ribosomal protein S11

UniProt:	P04969	Sequences: MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (123)
Sequences:	1835 (794)
Seq/√Len:	71.6

ECOLI - RS11
BACSU - RS11
HALSA - RS11
SULSO - RS11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_T	43_A	3.841	1.00
22_I	87_T	3.539	1.00
21_G	81_L	3.539	1.00
38_D	42_N	3.198	1.00
85_E	111_A	2.987	1.00
84_L	107_L	2.925	1.00
85_E	110_T	2.772	1.00
47_S	71_T	2.661	1.00
23_A	36_I	2.661	1.00
72_A	76_S	2.448	1.00
71_T	75_G	2.294	1.00
16_K	79_H	2.262	1.00
23_A	84_L	2.155	1.00
36_I	72_A	2.088	1.00
47_S	51_A	2.076	1.00
73_A	105_A	2.052	1.00
83_T	108_E	2.006	1.00
20_S	83_T	2.004	1.00
44_I	81_L	1.798	1.00
34_V	72_A	1.686	1.00
57_S	60_S	1.638	0.99
86_V	102_L	1.631	0.99
87_T	115_V	1.564	0.99
24_H	37_T	1.542	0.99
74_K	78_E	1.523	0.99
77_I	82_K	1.478	0.99
102_L	107_L	1.458	0.99
25_I	98_A	1.440	0.99
69_A	73_A	1.427	0.99
32_T	60_S	1.419	0.98
23_A	102_L	1.379	0.98
29_F	91_P	1.372	0.98
36_I	76_S	1.361	0.98
56_G	59_K	1.361	0.98
10_R	14_V	1.360	0.98
44_I	79_H	1.351	0.98
74_K	77_I	1.324	0.98
19_E	39_T	1.303	0.97
26_R	33_I	1.297	0.97
18_I	79_H	1.289	0.97
95_R	114_D	1.248	0.97
37_T	41_G	1.247	0.97
36_I	102_L	1.235	0.96
51_A	71_T	1.218	0.96
24_H	115_V	1.207	0.96
88_V	99_I	1.198	0.96
49_A	52_L	1.183	0.95
47_S	52_L	1.169	0.95
17_N	79_H	1.166	0.95
52_L	67_M	1.162	0.95
87_T	113_R	1.156	0.95
83_T	110_T	1.151	0.95
9_T	12_R	1.122	0.94
88_V	98_A	1.065	0.92
45_S	72_A	1.037	0.91
87_T	111_A	1.036	0.91
61_T	64_A	1.035	0.91
94_G	116_T	1.023	0.90
100_R	131_V	1.009	0.90
30_N	59_K	1.008	0.90
51_A	75_G	0.998	0.89
10_R	13_R	0.976	0.88
9_T	14_V	0.970	0.88
33_I	41_G	0.964	0.87
27_S	94_G	0.963	0.87
22_I	39_T	0.963	0.87
20_S	39_T	0.957	0.87
36_I	81_L	0.946	0.86
63_F	67_M	0.916	0.85
58_R	120_H	0.903	0.84
69_A	101_A	0.894	0.83
73_A	107_L	0.877	0.82
52_L	63_F	0.853	0.80
89_K	115_V	0.842	0.79
11_K	14_V	0.836	0.79
19_E	40_H	0.830	0.78
119_P	123_C	0.820	0.78
14_V	17_N	0.797	0.76
53_G	71_T	0.785	0.74
38_D	41_G	0.768	0.73
52_L	71_T	0.766	0.73
18_I	44_I	0.763	0.72
31_N	122_G	0.759	0.72
119_P	122_G	0.753	0.71
128_R	131_V	0.752	0.71
12_R	17_N	0.751	0.71
106_G	119_P	0.745	0.70
27_S	67_M	0.740	0.70
120_H	123_C	0.736	0.70
84_L	109_V	0.727	0.69
29_F	60_S	0.725	0.68
94_G	114_D	0.722	0.68
46_W	51_A	0.720	0.68
48_S	53_G	0.714	0.67
32_T	58_R	0.713	0.67
26_R	89_K	0.711	0.67
14_V	79_H	0.700	0.66
49_A	68_A	0.693	0.65
32_T	94_G	0.693	0.65
15_K	97_A	0.691	0.65
48_S	90_G	0.686	0.64
99_I	108_E	0.684	0.64
114_D	124_R	0.683	0.64
36_I	107_L	0.683	0.64
59_K	111_A	0.681	0.64
62_P	93_S	0.679	0.63
119_P	125_P	0.679	0.63
18_I	38_D	0.678	0.63
30_N	100_R	0.677	0.63
30_N	129_R	0.675	0.63
70_E	74_K	0.667	0.62
56_G	90_G	0.666	0.62
32_T	65_A	0.661	0.61
45_S	104_A	0.659	0.61
83_T	97_A	0.656	0.61
54_F	66_Q	0.651	0.60
54_F	129_R	0.651	0.60
14_V	75_G	0.648	0.60
29_F	70_E	0.638	0.59
27_S	62_P	0.630	0.58
26_R	93_S	0.629	0.57
103_Q	109_V	0.629	0.57
66_Q	95_R	0.626	0.57
124_R	129_R	0.622	0.57
60_S	64_A	0.619	0.56
91_P	97_A	0.615	0.56
96_E	100_R	0.610	0.55
48_S	51_A	0.609	0.55
48_S	124_R	0.608	0.55
65_A	72_A	0.608	0.55
25_I	115_V	0.607	0.55
59_K	62_P	0.601	0.54
39_T	108_E	0.598	0.54
55_R	75_G	0.598	0.54
10_R	40_H	0.597	0.54
26_R	129_R	0.596	0.53
23_A	72_A	0.589	0.53
44_I	59_K	0.588	0.52
81_L	98_A	0.584	0.52
13_R	26_R	0.577	0.51
57_S	67_M	0.576	0.51
24_H	87_T	0.575	0.51
82_K	126_P	0.573	0.51
63_F	120_H	0.573	0.51
17_N	75_G	0.570	0.50
27_S	99_I	0.570	0.50
52_L	68_A	0.569	0.50
26_R	35_T	0.569	0.50
76_S	79_H	0.567	0.50
14_V	19_E	0.566	0.50
54_F	64_A	0.563	0.49
90_G	122_G	0.563	0.49
97_A	101_A	0.562	0.49
10_R	19_E	0.562	0.49
75_G	79_H	0.556	0.49
45_S	78_E	0.556	0.49
26_R	110_T	0.555	0.48
62_P	91_P	0.555	0.48
66_Q	91_P	0.554	0.48
54_F	116_T	0.553	0.48
33_I	49_A	0.551	0.48
63_F	70_E	0.551	0.48
73_A	77_I	0.543	0.47
122_G	127_K	0.542	0.47
13_R	72_A	0.541	0.47
25_I	99_I	0.540	0.47
54_F	59_K	0.539	0.46
26_R	113_R	0.536	0.46
43_A	116_T	0.535	0.46
34_V	98_A	0.534	0.46
103_Q	111_A	0.532	0.46
30_N	88_V	0.529	0.45
20_S	110_T	0.528	0.45
19_E	43_A	0.528	0.45
66_Q	123_C	0.524	0.45
90_G	127_K	0.522	0.44
12_R	87_T	0.520	0.44
30_N	60_S	0.517	0.44
35_T	44_I	0.514	0.43
33_I	123_C	0.509	0.43
28_T	93_S	0.506	0.42
47_S	72_A	0.506	0.42
9_T	75_G	0.504	0.42
97_A	121_N	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rb5K	1	0.8702	100	0.042	Contact Map
3bbnK	1	0.8931	100	0.052	Contact Map
4tp8K	1	0.0153	100	0.07	Contact Map
3zeyH	1	0.8855	100	0.081	Contact Map
5aj3K	1	0.9466	100	0.082	Contact Map
3j7aP	1	0.8779	100	0.085	Contact Map
4ujpP	1	0.8779	100	0.098	Contact Map
4cvnE	1	0.8702	100	0.098	Contact Map
4rb6S	1	0.7939	97.2	0.836	Contact Map
4tp9O	1	0.0153	97.1	0.837	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.