SSPD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSPD - Small, acid-soluble spore protein D

UniProt:	P04833	Sequences: MASRNKLVVPGVEQALDQFKLEVAQEFGVNLGSDTVARANGSVGGEMTKRLVQQAQSQLNGTTK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	64 (59)
Sequences:	429 (147)
Seq/√Len:	19.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_T	51_L	3.025	0.99
42_S	46_E	2.739	0.98
27_F	46_E	2.627	0.98
40_N	43_V	2.280	0.95
15_A	19_F	2.230	0.94
19_F	23_V	1.952	0.89
23_V	50_R	1.922	0.88
37_A	40_N	1.894	0.87
53_Q	57_S	1.799	0.84
29_V	43_V	1.761	0.83
47_M	51_L	1.712	0.81
46_E	49_K	1.471	0.70
21_L	47_M	1.446	0.68
23_V	46_E	1.438	0.68
23_V	43_V	1.436	0.68
31_L	42_S	1.434	0.68
16_L	47_M	1.378	0.65
33_S	52_V	1.355	0.63
29_V	35_T	1.267	0.58
58_Q	61_G	1.196	0.54
42_S	49_K	1.117	0.48
37_A	49_K	1.085	0.46
8_V	16_L	1.071	0.46
36_V	39_A	1.071	0.46
13_E	17_D	1.065	0.45
17_D	21_L	1.062	0.45
48_T	52_V	1.060	0.45
26_E	50_R	1.054	0.45
35_T	40_N	1.049	0.44
42_S	61_G	1.039	0.44
53_Q	59_L	1.016	0.42
32_G	43_V	0.992	0.41
46_E	53_Q	0.989	0.40
21_L	26_E	0.980	0.40
32_G	35_T	0.971	0.39
54_Q	57_S	0.956	0.38
47_M	61_G	0.936	0.37
12_V	15_A	0.881	0.34
32_G	37_A	0.879	0.34
5_N	55_A	0.875	0.34
36_V	49_K	0.857	0.33
27_F	42_S	0.852	0.32
14_Q	30_N	0.850	0.32
48_T	61_G	0.841	0.32
9_V	58_Q	0.813	0.30
46_E	50_R	0.810	0.30
38_R	43_V	0.795	0.29
6_K	10_P	0.789	0.29
39_A	55_A	0.782	0.29
16_L	55_A	0.779	0.29
32_G	40_N	0.777	0.28
43_V	46_E	0.771	0.28
12_V	19_F	0.769	0.28
25_Q	55_A	0.712	0.25
29_V	32_G	0.709	0.25
29_V	34_D	0.703	0.25
38_R	53_Q	0.688	0.24
17_D	59_L	0.685	0.24
4_R	37_A	0.669	0.23
12_V	25_Q	0.668	0.23
56_Q	59_L	0.663	0.23
14_Q	60_N	0.660	0.23
29_V	37_A	0.656	0.23
19_F	52_V	0.641	0.22
4_R	58_Q	0.634	0.22
8_V	14_Q	0.631	0.22
31_L	34_D	0.630	0.21
33_S	36_V	0.621	0.21
7_L	11_G	0.612	0.21
11_G	17_D	0.611	0.21
13_E	35_T	0.606	0.20
9_V	16_L	0.602	0.20
7_L	10_P	0.589	0.20
19_F	60_N	0.578	0.19
5_N	59_L	0.575	0.19
28_G	47_M	0.565	0.19
53_Q	58_Q	0.562	0.19
32_G	57_S	0.557	0.18
35_T	49_K	0.555	0.18
11_G	53_Q	0.536	0.18
54_Q	58_Q	0.526	0.17
26_E	40_N	0.521	0.17
5_N	43_V	0.515	0.17
3_S	56_Q	0.509	0.17
32_G	42_S	0.507	0.17
28_G	51_L	0.504	0.17
11_G	60_N	0.504	0.17
12_V	59_L	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2z3xA	3	0.875	99.8	0.326	Contact Map
4bzjA	2	0	14.5	0.911	Contact Map
3frrA	1	0.6406	13	0.913	Contact Map
1a7jA	5	0.5469	9.9	0.917	Contact Map
3ggyA	1	0.5938	7.4	0.921	Contact Map
1wvfA	2	0.9375	5.6	0.926	Contact Map
4w23H	1	0.9219	5.2	0.927	Contact Map
5bwjA	2	0.3906	5.1	0.927	Contact Map
3sjrA	2	0.9219	4.7	0.929	Contact Map
2cdqA	2	1	4.4	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.