SSPB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSPB - Small, acid-soluble spore protein B

UniProt:	P04832	Sequences: MANQNSSNDLLVPGAAQAIDQMKLEIASEFGVNLGADTTSRANGSVGGEITKRLVSFAQQQMGGRVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	67 (60)
Sequences:	501 (205)
Seq/√Len:	26.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_T	54_L	3.643	1.00
45_S	49_E	3.123	1.00
43_N	46_V	2.591	0.99
50_I	54_L	2.342	0.98
56_S	60_Q	2.247	0.98
49_E	52_K	2.234	0.98
51_T	55_V	2.151	0.97
39_T	42_A	1.944	0.95
22_M	26_I	1.931	0.95
30_F	49_E	1.898	0.94
35_G	38_T	1.720	0.91
26_I	53_R	1.705	0.90
18_A	22_M	1.573	0.86
16_A	20_D	1.498	0.83
57_F	60_Q	1.491	0.83
40_S	43_N	1.461	0.82
32_V	46_V	1.387	0.78
45_S	52_K	1.256	0.71
34_L	45_S	1.243	0.70
19_I	50_I	1.222	0.69
50_I	64_G	1.217	0.68
19_I	55_V	1.149	0.64
49_E	56_S	1.124	0.62
35_G	43_N	1.124	0.62
38_T	43_N	1.091	0.60
32_V	38_T	1.044	0.56
49_E	53_R	1.035	0.56
22_M	58_A	0.983	0.52
35_G	46_V	0.971	0.51
14_G	60_Q	0.963	0.50
26_I	46_V	0.939	0.48
57_F	61_Q	0.915	0.47
34_L	43_N	0.907	0.46
12_V	61_Q	0.898	0.45
29_E	53_R	0.896	0.45
24_L	50_I	0.878	0.44
26_I	52_K	0.873	0.43
37_D	55_V	0.851	0.42
28_S	36_A	0.823	0.40
17_Q	59_Q	0.796	0.38
15_A	22_M	0.791	0.38
24_L	29_E	0.782	0.37
32_V	35_G	0.777	0.37
6_S	59_Q	0.773	0.36
61_Q	64_G	0.768	0.36
15_A	28_S	0.766	0.36
59_Q	62_M	0.762	0.36
10_L	36_A	0.759	0.35
14_G	56_S	0.758	0.35
15_A	37_D	0.757	0.35
54_L	58_A	0.736	0.34
16_A	19_I	0.733	0.34
10_L	13_P	0.733	0.34
29_E	40_S	0.702	0.32
17_Q	33_N	0.701	0.32
55_V	58_A	0.687	0.31
26_I	49_E	0.685	0.30
15_A	18_A	0.684	0.30
8_N	62_M	0.672	0.30
40_S	52_K	0.666	0.29
10_L	57_F	0.649	0.28
41_R	58_A	0.647	0.28
16_A	53_R	0.646	0.28
9_D	12_V	0.646	0.28
58_A	62_M	0.636	0.27
30_F	45_S	0.626	0.27
20_D	38_T	0.618	0.26
35_G	40_S	0.617	0.26
45_S	64_G	0.595	0.25
26_I	30_F	0.591	0.25
41_R	46_V	0.591	0.25
11_L	19_I	0.587	0.25
12_V	57_F	0.585	0.25
5_N	22_M	0.572	0.24
34_L	37_D	0.568	0.24
21_Q	64_G	0.559	0.23
11_L	41_R	0.549	0.23
52_K	60_Q	0.548	0.23
9_D	13_P	0.547	0.23
22_M	55_V	0.544	0.22
10_L	14_G	0.544	0.22
5_N	9_D	0.543	0.22
34_L	42_A	0.542	0.22
11_L	21_Q	0.536	0.22
41_R	56_S	0.527	0.21
32_V	37_D	0.527	0.21
46_V	49_E	0.521	0.21
19_I	54_L	0.506	0.20
37_D	56_S	0.500	0.20
16_A	28_S	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2z3xA	3	0.8358	99.9	0.301	Contact Map
3k44A	1	0.4627	12.3	0.912	Contact Map
4bzjA	2	0	8.6	0.918	Contact Map
3frrA	1	0.6567	6.7	0.922	Contact Map
3ggyA	1	0.6119	6.3	0.923	Contact Map
2qb7A	1	0.3582	5.6	0.925	Contact Map
3tviA	2	0.9403	3.8	0.93	Contact Map
4wz4A	1	0.3433	3.1	0.933	Contact Map
3h0gA	2	0.9851	3	0.934	Contact Map
1j5pA	2	0.8507	2.9	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.