RL7 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL7 - 50S ribosomal protein L7/L12

UniProt:	P02394	Sequences: MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGAAAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASVEVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (119)
Sequences:	2751 (1203)
Seq/√Len:	110.3

ECOLI - RL7
BACSU - RL7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_K	30_E	3.145	1.00
84_K	88_E	3.085	1.00
7_E	11_S	2.994	1.00
78_I	109_L	2.927	1.00
110_K	114_E	2.912	1.00
113_L	118_A	2.641	1.00
62_A	121_E	2.586	1.00
62_A	119_S	2.564	1.00
108_E	112_K	2.562	1.00
63_G	119_S	2.479	1.00
67_Q	70_K	2.448	1.00
74_V	77_E	2.289	1.00
60_I	96_P	2.269	1.00
111_A	115_E	2.242	1.00
77_E	112_K	2.151	1.00
64_A	91_D	1.720	1.00
5_I	15_A	1.698	1.00
58_D	100_G	1.665	1.00
88_E	92_N	1.603	1.00
10_A	14_E	1.549	1.00
8_I	11_S	1.546	1.00
53_E	103_K	1.540	1.00
21_N	25_K	1.523	1.00
102_A	105_E	1.520	1.00
110_K	120_V	1.483	1.00
9_I	27_I	1.468	1.00
17_V	20_L	1.451	1.00
75_V	90_V	1.440	1.00
105_E	108_E	1.437	1.00
70_K	116_V	1.434	1.00
13_K	31_F	1.432	1.00
10_A	13_K	1.409	1.00
107_E	111_A	1.339	1.00
108_E	111_A	1.299	0.99
98_K	105_E	1.276	0.99
7_E	10_A	1.243	0.99
54_Q	57_F	1.232	0.99
6_E	26_A	1.220	0.99
5_I	26_A	1.209	0.99
25_K	28_E	1.196	0.99
6_E	10_A	1.189	0.99
74_V	115_E	1.183	0.99
11_S	14_E	1.178	0.99
98_K	109_L	1.166	0.99
63_G	66_S	1.155	0.99
104_E	108_E	1.123	0.98
12_V	31_F	1.115	0.98
111_A	114_E	1.102	0.98
60_I	121_E	1.098	0.98
92_N	95_K	1.083	0.98
114_E	119_S	1.066	0.98
57_F	103_K	1.059	0.98
56_E	100_G	1.041	0.97
5_I	11_S	1.037	0.97
54_Q	58_D	1.032	0.97
67_Q	116_V	1.026	0.97
101_I	122_V	1.023	0.97
8_I	23_L	1.022	0.97
12_V	27_I	1.020	0.97
104_E	107_E	1.013	0.97
68_K	90_V	1.010	0.97
9_I	26_A	0.998	0.97
11_S	15_A	0.994	0.96
110_K	122_V	0.992	0.96
74_V	112_K	0.986	0.96
85_E	88_E	0.980	0.96
9_I	13_K	0.963	0.96
69_I	76_R	0.962	0.96
18_L	21_N	0.958	0.96
103_K	107_E	0.955	0.96
58_D	96_P	0.953	0.96
75_V	97_L	0.948	0.95
61_L	93_T	0.937	0.95
5_I	9_I	0.936	0.95
78_I	112_K	0.921	0.95
105_E	109_L	0.918	0.94
101_I	109_L	0.917	0.94
9_I	31_F	0.908	0.94
20_L	27_I	0.902	0.94
101_I	105_E	0.881	0.93
88_E	95_K	0.876	0.93
59_L	106_A	0.868	0.93
16_T	19_E	0.855	0.92
28_E	35_A	0.845	0.92
89_L	95_K	0.826	0.91
5_I	8_I	0.804	0.90
112_K	115_E	0.794	0.89
54_Q	100_G	0.792	0.89
8_I	26_A	0.791	0.89
62_A	94_P	0.771	0.88
90_V	93_T	0.770	0.87
28_E	34_T	0.758	0.87
58_D	99_E	0.757	0.87
8_I	12_V	0.756	0.86
21_N	27_I	0.755	0.86
89_L	97_L	0.735	0.85
15_A	31_F	0.735	0.85
45_A	49_G	0.732	0.85
82_G	85_E	0.722	0.84
76_R	79_T	0.719	0.84
96_P	99_E	0.717	0.83
47_A	51_A	0.710	0.83
59_L	109_L	0.709	0.83
46_A	49_G	0.706	0.82
114_E	122_V	0.704	0.82
76_R	81_L	0.702	0.82
62_A	123_K	0.689	0.81
114_E	120_V	0.683	0.80
72_I	76_R	0.682	0.80
26_A	30_E	0.681	0.80
23_L	27_I	0.679	0.80
69_I	72_I	0.673	0.79
78_I	113_L	0.673	0.79
9_I	30_E	0.673	0.79
15_A	27_I	0.672	0.79
55_S	122_V	0.672	0.79
90_V	94_P	0.668	0.79
54_Q	102_A	0.657	0.78
8_I	27_I	0.656	0.78
80_G	98_K	0.651	0.77
12_V	34_T	0.646	0.77
76_R	82_G	0.645	0.76
92_N	96_P	0.641	0.76
79_T	97_L	0.636	0.75
24_V	31_F	0.634	0.75
12_V	23_L	0.634	0.75
41_V	44_G	0.633	0.75
53_E	57_F	0.628	0.75
79_T	98_K	0.628	0.75
57_F	122_V	0.621	0.74
38_P	41_V	0.620	0.74
39_V	42_A	0.618	0.73
62_A	93_T	0.616	0.73
65_G	71_V	0.608	0.72
54_Q	103_K	0.606	0.72
13_K	27_I	0.606	0.72
48_G	51_A	0.601	0.71
47_A	50_A	0.599	0.71
79_T	82_G	0.595	0.71
107_E	122_V	0.589	0.70
61_L	68_K	0.587	0.70
21_N	24_V	0.583	0.69
19_E	22_D	0.579	0.69
81_L	89_L	0.575	0.68
113_L	120_V	0.569	0.67
74_V	78_I	0.567	0.67
60_I	123_K	0.564	0.66
43_G	46_A	0.564	0.66
89_L	96_P	0.561	0.66
69_I	91_D	0.557	0.66
46_A	51_A	0.555	0.65
28_E	33_V	0.555	0.65
12_V	17_V	0.547	0.64
25_K	29_E	0.545	0.64
70_K	74_V	0.537	0.63
25_K	32_G	0.537	0.63
113_L	116_V	0.536	0.63
65_G	118_A	0.532	0.62
20_L	23_L	0.528	0.61
12_V	30_E	0.524	0.61
6_E	30_E	0.523	0.61
12_V	15_A	0.523	0.61
61_L	118_A	0.520	0.60
28_E	31_F	0.519	0.60
8_I	15_A	0.516	0.60
45_A	48_G	0.515	0.60
44_G	47_A	0.514	0.59
101_I	106_A	0.513	0.59
7_E	15_A	0.513	0.59
58_D	123_K	0.511	0.59
5_I	20_L	0.509	0.59
66_S	119_S	0.508	0.59
68_K	93_T	0.507	0.58
5_I	30_E	0.506	0.58
34_T	37_A	0.506	0.58
15_A	20_L	0.505	0.58
61_L	64_A	0.500	0.57
56_E	102_A	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kix6	1	0.2439	100	0.053	Contact Map
2zjq5	1	0.5772	100	0.062	Contact Map
1dd3A	6	0.9837	100	0.08	Contact Map
2ftcE	2	0.9837	100	0.112	Contact Map
1ctfA	2	0.5528	99.9	0.338	Contact Map
4qs1e	1	0.5854	99.9	0.379	Contact Map
4kcze	1	0.5854	99.9	0.382	Contact Map
1dd4C	7	0.3252	98.3	0.752	Contact Map
1zavU	5	0.2439	97.1	0.81	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.