ACYP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACYP - Acylphosphatase

UniProt:	O35031	Sequences: MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	91 (84)
Sequences:	1986 (1587)
Seq/√Len:	173.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_F	59_A	2.854	1.00
46_A	56_F	2.741	1.00
24_E	27_K	2.734	1.00
7_I	41_R	2.693	1.00
16_G	19_Y	2.565	1.00
9_D	41_R	2.418	1.00
9_D	71_D	2.208	1.00
37_R	43_E	2.133	1.00
6_I	57_V	1.790	1.00
6_I	60_V	1.740	1.00
5_R	43_E	1.739	1.00
47_E	82_G	1.734	1.00
37_R	41_R	1.716	1.00
22_Q	26_D	1.675	1.00
21_V	56_F	1.579	1.00
64_S	67_S	1.550	1.00
44_I	60_V	1.515	1.00
6_I	44_I	1.487	1.00
6_I	46_A	1.414	1.00
6_I	74_V	1.391	1.00
47_E	81_E	1.328	1.00
35_K	43_E	1.320	1.00
9_D	73_S	1.320	1.00
49_P	52_A	1.309	1.00
46_A	53_L	1.306	1.00
31_A	85_R	1.263	1.00
57_V	74_V	1.262	1.00
4_Y	76_E	1.259	1.00
46_A	60_V	1.240	1.00
50_E	54_Q	1.218	1.00
21_V	60_V	1.189	1.00
45_L	77_S	1.158	1.00
19_Y	22_Q	1.134	1.00
30_L	48_G	1.129	1.00
5_R	33_W	1.115	1.00
45_L	83_H	1.108	1.00
19_Y	23_M	1.084	1.00
24_E	59_A	1.077	1.00
8_V	60_V	1.052	1.00
33_W	45_L	1.021	0.99
61_K	72_I	1.020	0.99
8_V	72_I	1.006	0.99
8_V	44_I	0.974	0.99
28_R	59_A	0.973	0.99
16_G	66_F	0.964	0.99
28_R	55_S	0.963	0.99
47_E	79_S	0.949	0.99
7_I	37_R	0.947	0.99
34_V	44_I	0.943	0.99
28_R	56_F	0.943	0.99
24_E	28_R	0.924	0.99
54_Q	58_E	0.923	0.99
52_A	55_S	0.920	0.99
22_Q	88_I	0.919	0.99
44_I	56_F	0.916	0.99
57_V	61_K	0.906	0.99
33_W	43_E	0.902	0.98
5_R	77_S	0.894	0.98
29_K	52_A	0.892	0.98
33_W	44_I	0.881	0.98
7_I	43_E	0.864	0.98
58_E	61_K	0.854	0.98
50_E	76_E	0.843	0.98
20_F	67_S	0.840	0.98
16_G	20_F	0.833	0.97
16_G	23_M	0.827	0.97
45_L	82_G	0.824	0.97
21_V	46_A	0.824	0.97
4_Y	74_V	0.821	0.97
79_S	83_H	0.820	0.97
20_F	24_E	0.820	0.97
4_Y	57_V	0.810	0.97
31_A	47_E	0.809	0.97
30_L	46_A	0.807	0.97
20_F	63_G	0.803	0.97
4_Y	53_L	0.796	0.97
21_V	34_V	0.779	0.96
23_M	26_D	0.775	0.96
84_H	87_S	0.766	0.96
31_A	83_H	0.763	0.96
63_G	67_S	0.760	0.96
47_E	83_H	0.757	0.96
17_F	60_V	0.753	0.95
5_R	75_T	0.753	0.95
16_G	65_P	0.753	0.95
4_Y	46_A	0.743	0.95
48_G	52_A	0.734	0.95
28_R	52_A	0.727	0.94
5_R	45_L	0.678	0.92
79_S	82_G	0.674	0.92
11_R	68_K	0.667	0.92
22_Q	34_V	0.650	0.90
83_H	87_S	0.640	0.90
7_I	39_D	0.618	0.88
33_W	37_R	0.613	0.88
53_L	57_V	0.606	0.87
54_Q	74_V	0.603	0.87
21_V	59_A	0.600	0.87
20_F	64_S	0.595	0.86
55_S	59_A	0.595	0.86
45_L	81_E	0.594	0.86
6_I	72_I	0.588	0.86
26_D	85_R	0.578	0.85
19_Y	66_F	0.569	0.84
11_R	16_G	0.561	0.83
55_S	58_E	0.551	0.82
70_T	87_S	0.549	0.81
12_V	42_V	0.546	0.81
27_K	51_N	0.545	0.81
77_S	83_H	0.543	0.81
7_I	73_S	0.541	0.80
35_K	79_S	0.540	0.80
8_V	63_G	0.537	0.80
26_D	78_R	0.530	0.79
8_V	21_V	0.525	0.78
17_F	21_V	0.521	0.78
52_A	56_F	0.514	0.77
49_P	76_E	0.511	0.77
70_T	75_T	0.510	0.76
7_I	38_D	0.508	0.76
16_G	21_V	0.506	0.76
58_E	62_N	0.506	0.76
63_G	69_V	0.506	0.76
33_W	48_G	0.501	0.75
23_M	27_K	0.500	0.75
47_E	77_S	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g9iA	1	0.989	100	0.152	Contact Map
2lxfA	1	0.978	100	0.156	Contact Map
2fhmA	1	1	100	0.157	Contact Map
2bjdA	1	0.978	100	0.172	Contact Map
3trgA	1	0.967	100	0.175	Contact Map
1ulrA	1	0.956	100	0.176	Contact Map
1w2iA	2	0.978	100	0.177	Contact Map
1urrA	1	0.989	100	0.177	Contact Map
3vthA	1	0.978	100	0.18	Contact Map
4hi1A	3	0.967	100	0.181	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.