YFKJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFKJ - Low molecular weight protein-tyrosine-phosphatase YfkJ

UniProt:	O35016	Sequences: MISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRREGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (144)
Sequences:	4702 (3527)
Seq/√Len:	293.9

ECOLI - WZB ETP
BACSU - YFKJ PAP ARSC
HALSA - ARSC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_L	144_E	3.354	1.00
24_D	28_K	3.264	1.00
19_E	23_R	2.904	1.00
74_V	96_L	2.798	1.00
87_A	96_L	2.456	1.00
124_P	138_L	2.435	1.00
3_S	36_K	2.353	1.00
59_L	66_F	2.120	1.00
9_L	92_N	2.109	1.00
17_M	55_T	2.075	1.00
90_A	122_D	2.070	1.00
61_R	133_E	1.853	1.00
6_F	22_F	1.839	1.00
27_A	32_E	1.802	1.00
5_L	40_A	1.785	1.00
38_D	72_R	1.762	1.00
58_I	133_E	1.709	1.00
111_L	143_C	1.684	1.00
17_M	59_L	1.665	1.00
93_I	97_R	1.584	1.00
109_K	114_Y	1.570	1.00
77_Q	81_D	1.566	1.00
62_E	140_K	1.510	1.00
4_V	22_F	1.481	1.00
87_A	93_I	1.480	1.00
26_A	35_I	1.448	1.00
62_E	136_C	1.441	1.00
111_L	139_I	1.435	1.00
25_L	140_K	1.435	1.00
38_D	82_F	1.433	1.00
58_I	61_R	1.428	1.00
26_A	37_A	1.423	1.00
36_K	81_D	1.417	1.00
58_I	136_C	1.411	1.00
47_I	71_A	1.386	1.00
21_I	136_C	1.385	1.00
9_L	43_G	1.384	1.00
72_R	78_D	1.381	1.00
21_I	139_I	1.373	1.00
62_E	137_Q	1.358	1.00
90_A	110_R	1.353	1.00
42_I	95_S	1.341	1.00
25_L	143_C	1.330	1.00
22_F	37_A	1.318	1.00
47_I	73_Q	1.310	1.00
134_E	138_L	1.309	1.00
51_P	56_Q	1.301	1.00
21_I	143_C	1.295	1.00
50_P	56_Q	1.250	1.00
112_L	115_V	1.244	1.00
56_Q	66_F	1.215	1.00
109_K	113_D	1.214	1.00
20_A	66_F	1.201	1.00
64_I	140_K	1.197	1.00
51_P	66_F	1.190	1.00
112_L	138_L	1.178	1.00
46_H	49_N	1.175	1.00
110_R	122_D	1.165	1.00
20_A	64_I	1.149	1.00
93_I	108_I	1.141	1.00
23_R	37_A	1.137	1.00
51_P	69_M	1.130	1.00
101_G	104_N	1.119	1.00
29_K	148_A	1.118	1.00
97_R	108_I	1.113	1.00
79_L	85_I	1.090	1.00
58_I	62_E	1.089	1.00
44_G	73_Q	1.086	1.00
40_A	72_R	1.085	1.00
79_L	104_N	1.077	1.00
114_Y	149_S	1.057	1.00
24_D	27_A	1.045	1.00
18_A	88_M	1.042	1.00
56_Q	60_R	1.042	1.00
3_S	81_D	1.034	1.00
22_F	143_C	1.033	1.00
55_T	58_I	1.029	1.00
114_Y	146_L	0.999	1.00
140_K	144_E	0.999	1.00
115_V	141_T	0.994	1.00
57_E	61_R	0.980	1.00
96_L	108_I	0.978	1.00
145_Q	148_A	0.977	1.00
89_D	92_N	0.972	1.00
95_S	98_S	0.971	1.00
91_E	95_S	0.968	1.00
88_M	111_L	0.967	1.00
76_E	99_M	0.963	1.00
93_I	110_R	0.961	1.00
87_A	110_R	0.952	1.00
133_E	137_Q	0.947	1.00
135_V	139_I	0.934	1.00
84_Y	146_L	0.927	1.00
84_Y	109_K	0.922	1.00
86_I	146_L	0.913	1.00
20_A	69_M	0.901	1.00
74_V	79_L	0.898	1.00
42_I	96_L	0.898	1.00
17_M	136_C	0.897	1.00
104_N	107_H	0.897	1.00
25_L	28_K	0.896	1.00
111_L	142_G	0.895	1.00
20_A	23_R	0.887	1.00
25_L	29_K	0.887	1.00
25_L	147_L	0.887	1.00
52_H	132_F	0.886	1.00
100_A	108_I	0.882	1.00
86_I	109_K	0.882	1.00
95_S	99_M	0.881	1.00
6_F	18_A	0.880	1.00
9_L	91_E	0.880	1.00
53_E	57_E	0.879	1.00
20_A	51_P	0.875	1.00
5_L	82_F	0.870	1.00
7_V	85_I	0.847	1.00
112_L	142_G	0.843	1.00
43_G	47_I	0.842	1.00
146_L	150_I	0.840	1.00
29_K	144_E	0.833	1.00
88_M	123_V	0.824	1.00
51_P	59_L	0.821	1.00
64_I	136_C	0.820	1.00
54_G	129_T	0.819	1.00
44_G	47_I	0.810	1.00
120_L	134_E	0.807	1.00
97_R	100_A	0.804	1.00
113_D	120_L	0.801	1.00
116_E	141_T	0.796	0.99
86_I	114_Y	0.793	0.99
7_V	96_L	0.775	0.99
66_F	69_M	0.773	0.99
40_A	74_V	0.765	0.99
26_A	147_L	0.754	0.99
45_W	49_N	0.744	0.99
21_I	64_I	0.743	0.99
109_K	149_S	0.740	0.99
77_Q	80_D	0.738	0.99
3_S	82_F	0.734	0.99
136_C	140_K	0.731	0.99
131_N	134_E	0.729	0.99
60_R	66_F	0.725	0.99
17_M	58_I	0.724	0.99
9_L	89_D	0.703	0.99
79_L	100_A	0.698	0.99
5_L	72_R	0.697	0.99
85_I	96_L	0.695	0.99
100_A	104_N	0.691	0.99
114_Y	145_Q	0.685	0.98
50_P	70_L	0.682	0.98
80_D	104_N	0.682	0.98
117_D	141_T	0.678	0.98
52_H	129_T	0.675	0.98
79_L	96_L	0.674	0.98
86_I	111_L	0.664	0.98
18_A	111_L	0.658	0.98
78_D	82_F	0.658	0.98
22_F	25_L	0.654	0.98
65_S	68_G	0.654	0.98
76_E	80_D	0.654	0.98
110_R	113_D	0.653	0.98
115_V	145_Q	0.649	0.98
75_S	78_D	0.646	0.98
23_R	27_A	0.643	0.98
79_L	101_G	0.639	0.98
5_L	85_I	0.628	0.97
44_G	49_N	0.627	0.97
43_G	46_H	0.625	0.97
88_M	92_N	0.624	0.97
18_A	139_I	0.622	0.97
26_A	31_L	0.616	0.97
62_E	133_E	0.616	0.97
100_A	106_S	0.612	0.97
115_V	146_L	0.611	0.97
17_M	135_V	0.608	0.97
123_V	142_G	0.607	0.97
3_S	38_D	0.606	0.97
43_G	95_S	0.601	0.96
22_F	146_L	0.597	0.96
55_T	59_L	0.596	0.96
72_R	82_F	0.596	0.96
29_K	147_L	0.595	0.96
54_G	130_G	0.592	0.96
135_V	138_L	0.586	0.96
100_A	107_H	0.585	0.96
139_I	143_C	0.583	0.96
60_R	65_S	0.582	0.96
84_Y	114_Y	0.581	0.96
9_L	95_S	0.579	0.96
84_Y	150_I	0.577	0.96
116_E	121_A	0.573	0.95
20_A	68_G	0.567	0.95
11_N	15_S	0.567	0.95
40_A	78_D	0.558	0.95
123_V	138_L	0.552	0.94
20_A	67_D	0.552	0.94
43_G	73_Q	0.551	0.94
111_L	146_L	0.547	0.94
112_L	122_D	0.545	0.94
38_D	81_D	0.544	0.94
124_P	135_V	0.543	0.94
59_L	64_I	0.543	0.94
20_A	65_S	0.541	0.94
50_P	69_M	0.541	0.94
12_I	132_F	0.540	0.94
102_F	105_T	0.539	0.94
21_I	140_K	0.538	0.94
52_H	127_Y	0.534	0.93
128_Y	131_N	0.532	0.93
6_F	143_C	0.525	0.93
26_A	32_E	0.519	0.92
131_N	135_V	0.518	0.92
146_L	149_S	0.513	0.92
21_I	25_L	0.508	0.92
12_I	52_H	0.505	0.91
49_N	71_A	0.500	0.91
41_G	87_A	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4etmA	2	1	100	0.127	Contact Map
2gi4A	1	0.9936	100	0.13	Contact Map
3jviA	1	0.9808	100	0.15	Contact Map
3rofA	1	0.9679	100	0.151	Contact Map
4lrqA	2	0.9487	100	0.154	Contact Map
1d1qA	1	0.9615	100	0.163	Contact Map
2cwdA	1	0.9359	100	0.168	Contact Map
3n8iA	1	0.9551	100	0.177	Contact Map
1u2pA	1	0.9744	100	0.179	Contact Map
4picA	2	0.9423	100	0.197	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.